Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|2327
Gene name
Locationscaffold_199:10663..12228
Strand+
Gene length (bp)1565
Transcript length (bp)1458
Coding sequence length (bp)1455
Protein length (aa) 485

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q5UQ50|COLL6_MIMIV Collagen-like protein 6 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L668 PE=4 SV=1 322 452 2.0E-10
sp|Q5UQ50|COLL6_MIMIV Collagen-like protein 6 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L668 PE=4 SV=1 322 428 3.0E-09
sp|Q5UQ50|COLL6_MIMIV Collagen-like protein 6 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L668 PE=4 SV=1 334 425 5.0E-09
sp|A6H584|CO6A5_MOUSE Collagen alpha-5(VI) chain OS=Mus musculus GN=Col6a5 PE=1 SV=4 338 415 6.0E-09
sp|Q5UQ50|COLL6_MIMIV Collagen-like protein 6 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L668 PE=4 SV=1 325 425 7.0E-09
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q5UQ50|COLL6_MIMIV Collagen-like protein 6 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L668 PE=4 SV=1 322 452 2.0E-10
sp|Q5UQ50|COLL6_MIMIV Collagen-like protein 6 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L668 PE=4 SV=1 322 428 3.0E-09
sp|Q5UQ50|COLL6_MIMIV Collagen-like protein 6 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L668 PE=4 SV=1 334 425 5.0E-09
sp|A6H584|CO6A5_MOUSE Collagen alpha-5(VI) chain OS=Mus musculus GN=Col6a5 PE=1 SV=4 338 415 6.0E-09
sp|Q5UQ50|COLL6_MIMIV Collagen-like protein 6 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L668 PE=4 SV=1 325 425 7.0E-09
sp|Q5UQ50|COLL6_MIMIV Collagen-like protein 6 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L668 PE=4 SV=1 334 428 1.0E-08
sp|Q5UQ50|COLL6_MIMIV Collagen-like protein 6 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L668 PE=4 SV=1 328 425 1.0E-08
sp|Q5UQ50|COLL6_MIMIV Collagen-like protein 6 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L668 PE=4 SV=1 328 425 2.0E-08
sp|Q5UQ50|COLL6_MIMIV Collagen-like protein 6 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L668 PE=4 SV=1 338 425 3.0E-08
sp|A8TX70|CO6A5_HUMAN Collagen alpha-5(VI) chain OS=Homo sapiens GN=COL6A5 PE=1 SV=1 334 415 4.0E-08
sp|Q5UPE4|COLL1_MIMIV Collagen-like protein 1 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L71 PE=4 SV=1 332 425 4.0E-08
sp|A6NMZ7|CO6A6_HUMAN Collagen alpha-6(VI) chain OS=Homo sapiens GN=COL6A6 PE=1 SV=2 339 425 4.0E-08
sp|Q5UQ50|COLL6_MIMIV Collagen-like protein 6 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L668 PE=4 SV=1 322 425 4.0E-08
sp|Q5UPE4|COLL1_MIMIV Collagen-like protein 1 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L71 PE=4 SV=1 334 431 8.0E-08
sp|Q5UNS9|COLL7_MIMIV Collagen-like protein 7 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L669 PE=4 SV=1 337 431 1.0E-07
sp|A6H584|CO6A5_MOUSE Collagen alpha-5(VI) chain OS=Mus musculus GN=Col6a5 PE=1 SV=4 337 414 1.0E-07
sp|Q5UPE4|COLL1_MIMIV Collagen-like protein 1 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L71 PE=4 SV=1 331 415 1.0E-07
sp|A6NMZ7|CO6A6_HUMAN Collagen alpha-6(VI) chain OS=Homo sapiens GN=COL6A6 PE=1 SV=2 338 414 1.0E-07
sp|Q5UPE4|COLL1_MIMIV Collagen-like protein 1 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L71 PE=4 SV=1 328 424 2.0E-07
sp|P12111|CO6A3_HUMAN Collagen alpha-3(VI) chain OS=Homo sapiens GN=COL6A3 PE=1 SV=5 335 425 2.0E-07
sp|Q5UPE4|COLL1_MIMIV Collagen-like protein 1 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L71 PE=4 SV=1 320 425 3.0E-07
sp|Q5UNS9|COLL7_MIMIV Collagen-like protein 7 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L669 PE=4 SV=1 337 428 3.0E-07
sp|Q5UNS9|COLL7_MIMIV Collagen-like protein 7 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L669 PE=4 SV=1 338 425 4.0E-07
sp|A6H584|CO6A5_MOUSE Collagen alpha-5(VI) chain OS=Mus musculus GN=Col6a5 PE=1 SV=4 338 415 5.0E-07
sp|Q5UPE4|COLL1_MIMIV Collagen-like protein 1 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L71 PE=4 SV=1 337 431 5.0E-07
sp|Q5UQ50|COLL6_MIMIV Collagen-like protein 6 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L668 PE=4 SV=1 350 428 5.0E-07
sp|Q5UNS9|COLL7_MIMIV Collagen-like protein 7 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L669 PE=4 SV=1 337 434 7.0E-07
sp|A6H584|CO6A5_MOUSE Collagen alpha-5(VI) chain OS=Mus musculus GN=Col6a5 PE=1 SV=4 338 408 7.0E-07
sp|A6H584|CO6A5_MOUSE Collagen alpha-5(VI) chain OS=Mus musculus GN=Col6a5 PE=1 SV=4 337 414 8.0E-07
sp|Q5UNS9|COLL7_MIMIV Collagen-like protein 7 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L669 PE=4 SV=1 331 425 1.0E-06
sp|Q5UNS9|COLL7_MIMIV Collagen-like protein 7 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L669 PE=4 SV=1 334 434 1.0E-06
sp|A8TX70|CO6A5_HUMAN Collagen alpha-5(VI) chain OS=Homo sapiens GN=COL6A5 PE=1 SV=1 338 425 1.0E-06
sp|Q5UQ50|COLL6_MIMIV Collagen-like protein 6 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L668 PE=4 SV=1 337 414 1.0E-06
sp|Q5UNS9|COLL7_MIMIV Collagen-like protein 7 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L669 PE=4 SV=1 337 425 2.0E-06
sp|Q5UPE4|COLL1_MIMIV Collagen-like protein 1 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L71 PE=4 SV=1 334 415 2.0E-06
sp|Q5UNS9|COLL7_MIMIV Collagen-like protein 7 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L669 PE=4 SV=1 334 430 2.0E-06
sp|P15988|CO6A2_CHICK Collagen alpha-2(VI) chain OS=Gallus gallus GN=COL6A2 PE=2 SV=1 338 424 2.0E-06
sp|Q5UNS9|COLL7_MIMIV Collagen-like protein 7 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L669 PE=4 SV=1 337 425 3.0E-06
sp|Q5UQ50|COLL6_MIMIV Collagen-like protein 6 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L668 PE=4 SV=1 337 437 3.0E-06
sp|Q5UPE4|COLL1_MIMIV Collagen-like protein 1 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L71 PE=4 SV=1 331 415 4.0E-06
sp|Q5UQ50|COLL6_MIMIV Collagen-like protein 6 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L668 PE=4 SV=1 334 424 4.0E-06
sp|P15989|CO6A3_CHICK Collagen alpha-3(VI) chain OS=Gallus gallus GN=COL6A3 PE=2 SV=2 335 478 5.0E-06
sp|Q5UNS9|COLL7_MIMIV Collagen-like protein 7 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L669 PE=4 SV=1 337 424 6.0E-06
sp|A6H584|CO6A5_MOUSE Collagen alpha-5(VI) chain OS=Mus musculus GN=Col6a5 PE=1 SV=4 344 414 6.0E-06
sp|Q801S8|CO6A1_XENLA Collagen alpha-1(VI) chain OS=Xenopus laevis GN=col6a1 PE=1 SV=1 338 416 7.0E-06
sp|Q5UQ50|COLL6_MIMIV Collagen-like protein 6 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L668 PE=4 SV=1 337 428 7.0E-06
sp|Q5UNS9|COLL7_MIMIV Collagen-like protein 7 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L669 PE=4 SV=1 338 414 8.0E-06
sp|A8TX70|CO6A5_HUMAN Collagen alpha-5(VI) chain OS=Homo sapiens GN=COL6A5 PE=1 SV=1 336 414 9.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 20 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|2327
MHAGTLLTALVGMSAVAEAAELSRRTAFASILERRQSRSNDGSNNGIDFGNPLLFNRQFRKGNGRQGGGQNNQGG
GQNNQGQGGRQNNNGNQFTLGRNEINKASATNGQGKNQKGVQAKQAPSNTDNANFLHFCSQTGQKLTEGLQQKQG
SCNPIPMGQIPAVNKMASSIIVSPQACQQLQANQPFQVQAVIQNVRLGVFTNPTVTYYTAPVQLNQQGIPIGHTH
ISIQELGNSLNPQRPPNAQQFAFFKGFDDAGQDLGNNNILAKVDVAEGLAAGCYRVCTMAGGANHQCLNMPVAQR
GPGDDCQKFAVGNVNCGCAQNNNNNNNNNNNNNNNNNRGNQGGQGNQGGQGGRGNQGGQGNQGNQGGRGNQGGQG
NQGNQGNQGGRGNQGNQGGRGNQGGQGNQGNQGGQGNQGNNAQDQQRGQQQQQQQIQQQQQQQIQQARQQQQAQQ
QAAAQQQQAAAQQQGGGGGQRGGNGQRGGKQGGRK
Coding >Ophio5|2327
ATGCACGCGGGCACCCTCCTGACAGCCCTTGTGGGCATGTCGGCCGTCGCTGAAGCTGCCGAACTTTCTCGTCGC
ACCGCTTTTGCCAGCATCCTCGAACGACGACAGAGCAGATCCAACGACGGCTCTAACAACGGCATTGACTTTGGA
AATCCGCTTTTGTTCAACAGGCAATTCAGAAAGGGAAACGGTCGGCAAGGCGGCGGACAAAACAATCAAGGCGGC
GGGCAGAACAATCAAGGCCAAGGCGGTCGCCAGAACAACAATGGCAACCAGTTCACGCTCGGAAGGAATGAAATC
AACAAGGCCTCTGCGACCAATGGACAAGGCAAAAATCAGAAGGGAGTGCAGGCTAAACAGGCCCCCTCGAACACT
GACAACGCCAACTTCCTCCACTTTTGTAGCCAGACGGGTCAGAAACTCACAGAAGGCCTCCAGCAGAAGCAGGGT
TCCTGCAACCCAATCCCCATGGGCCAAATTCCCGCCGTCAACAAAATGGCCTCGAGCATCATTGTGTCCCCTCAG
GCGTGTCAGCAACTCCAGGCCAACCAGCCCTTCCAGGTCCAAGCCGTTATCCAAAACGTGAGACTTGGAGTATTC
ACCAACCCAACCGTCACTTACTACACCGCACCAGTGCAGCTGAACCAACAGGGAATCCCCATTGGCCACACCCAC
ATTTCCATACAAGAACTTGGGAATAGCCTCAACCCCCAACGGCCCCCTAATGCCCAGCAGTTCGCGTTTTTCAAG
GGTTTTGACGACGCCGGTCAAGACCTGGGCAACAACAATATCCTAGCCAAAGTCGACGTTGCCGAGGGTCTTGCA
GCGGGCTGCTATCGTGTCTGCACCATGGCGGGCGGCGCCAACCACCAGTGCCTGAACATGCCCGTCGCCCAGAGA
GGCCCTGGCGATGACTGCCAGAAGTTTGCCGTGGGCAATGTCAACTGCGGCTGTGCGCAGAACAACAACAACAAC
AACAACAACAACAACAACAATAACAACAATAACAACCGAGGCAACCAGGGCGGCCAAGGCAACCAGGGCGGCCAG
GGCGGTCGAGGTAACCAGGGCGGCCAGGGCAACCAGGGCAACCAGGGCGGTCGAGGCAACCAGGGCGGCCAGGGC
AACCAGGGCAATCAGGGCAACCAGGGCGGTCGAGGCAACCAGGGCAACCAGGGCGGTCGAGGCAACCAGGGCGGC
CAAGGCAATCAGGGCAACCAGGGCGGCCAAGGCAATCAGGGCAACAACGCCCAGGACCAGCAGCGTGGCCAGCAG
CAGCAGCAGCAACAGATTCAACAGCAGCAACAGCAGCAGATTCAACAGGCTCGGCAGCAGCAACAAGCCCAGCAG
CAGGCAGCAGCCCAGCAGCAGCAGGCGGCAGCCCAGCAGCAGGGCGGCGGGGGCGGCCAGCGGGGCGGCAATGGC
CAACGGGGTGGAAAGCAAGGAGGGCGGAAA
Transcript >Ophio5|2327
ATGCACGCGGGCACCCTCCTGACAGCCCTTGTGGGCATGTCGGCCGTCGCTGAAGCTGCCGAACTTTCTCGTCGC
ACCGCTTTTGCCAGCATCCTCGAACGACGACAGAGCAGATCCAACGACGGCTCTAACAACGGCATTGACTTTGGA
AATCCGCTTTTGTTCAACAGGCAATTCAGAAAGGGAAACGGTCGGCAAGGCGGCGGACAAAACAATCAAGGCGGC
GGGCAGAACAATCAAGGCCAAGGCGGTCGCCAGAACAACAATGGCAACCAGTTCACGCTCGGAAGGAATGAAATC
AACAAGGCCTCTGCGACCAATGGACAAGGCAAAAATCAGAAGGGAGTGCAGGCTAAACAGGCCCCCTCGAACACT
GACAACGCCAACTTCCTCCACTTTTGTAGCCAGACGGGTCAGAAACTCACAGAAGGCCTCCAGCAGAAGCAGGGT
TCCTGCAACCCAATCCCCATGGGCCAAATTCCCGCCGTCAACAAAATGGCCTCGAGCATCATTGTGTCCCCTCAG
GCGTGTCAGCAACTCCAGGCCAACCAGCCCTTCCAGGTCCAAGCCGTTATCCAAAACGTGAGACTTGGAGTATTC
ACCAACCCAACCGTCACTTACTACACCGCACCAGTGCAGCTGAACCAACAGGGAATCCCCATTGGCCACACCCAC
ATTTCCATACAAGAACTTGGGAATAGCCTCAACCCCCAACGGCCCCCTAATGCCCAGCAGTTCGCGTTTTTCAAG
GGTTTTGACGACGCCGGTCAAGACCTGGGCAACAACAATATCCTAGCCAAAGTCGACGTTGCCGAGGGTCTTGCA
GCGGGCTGCTATCGTGTCTGCACCATGGCGGGCGGCGCCAACCACCAGTGCCTGAACATGCCCGTCGCCCAGAGA
GGCCCTGGCGATGACTGCCAGAAGTTTGCCGTGGGCAATGTCAACTGCGGCTGTGCGCAGAACAACAACAACAAC
AACAACAACAACAACAACAATAACAACAATAACAACCGAGGCAACCAGGGCGGCCAAGGCAACCAGGGCGGCCAG
GGCGGTCGAGGTAACCAGGGCGGCCAGGGCAACCAGGGCAACCAGGGCGGTCGAGGCAACCAGGGCGGCCAGGGC
AACCAGGGCAATCAGGGCAACCAGGGCGGTCGAGGCAACCAGGGCAACCAGGGCGGTCGAGGCAACCAGGGCGGC
CAAGGCAATCAGGGCAACCAGGGCGGCCAAGGCAATCAGGGCAACAACGCCCAGGACCAGCAGCGTGGCCAGCAG
CAGCAGCAGCAACAGATTCAACAGCAGCAACAGCAGCAGATTCAACAGGCTCGGCAGCAGCAACAAGCCCAGCAG
CAGGCAGCAGCCCAGCAGCAGCAGGCGGCAGCCCAGCAGCAGGGCGGCGGGGGCGGCCAGCGGGGCGGCAATGGC
CAACGGGGTGGAAAGCAAGGAGGGCGGAAATAG
Gene >Ophio5|2327
ATGCACGCGGGCACCCTCCTGACAGCCCTTGTGGGCATGTCGGCCGTCGCTGAAGCTGCCGAACTTTCTCGTCGC
ACCGCTTTTGCCAGCATCCTCGAACGACGACAGAGCAGATCCAACGACGGCTCTAACAACGGCATTGACTTTGGA
AATCCGCTTTTGTTCAACAGGCAATTCAGAAAGGGAAACGGTCGGCAAGGCGGCGGACAAAACAATCAAGGCGGC
GGGCAGAACAATCAAGGCCAAGGCGGTCGCCAGAACAACAATGGCAACCAGTTCACGCTCGGAAGGAATGAAATC
AACAAGGCCTCTGCGACCAATGGACAAGGCAAAAATCAGAAGGGAGTGCAGGCTAAACAGGCCCCCTCGAACACG
TAAGTACACCGCGAATCCAGGCGTCAAATGGTCAACTTACTAACCTGTGAACAGTGACAACGCCAACTTCCTCCA
CTTTTGTAGCCAGACGGGTCAGAAACTCACAGAAGGCCTCCAGCAGAAGCAGGGTTCCTGCAACCCAATCCGTGA
GTCTCCCCGCAACGTCCACTAGCCTAACTCGTCTGATGTGGTATACAGCCATGGGCCAAATTCCCGCCGTCAACA
AAATGGCCTCGAGCATCATTGTGTCCCCTCAGGCGTGTCAGCAACTCCAGGCCAACCAGCCCTTCCAGGTCCAAG
CCGTTATCCAAAACGTGAGACTTGGAGTATTCACCAACCCAACCGTCACTTACTACACCGCACCAGTGCAGCTGA
ACCAACAGGGAATCCCCATTGGCCACACCCACATTTCCATACAAGAACTTGGGAATAGCCTCAACCCCCAACGGC
CCCCTAATGCCCAGCAGTTCGCGTTTTTCAAGGGTTTTGACGACGCCGGTCAAGACCTGGGCAACAACAATATCC
TAGCCAAAGTCGACGTTGCCGAGGGTCTTGCAGCGGGCTGCTATCGTGTCTGCACCATGGCGGGCGGCGCCAACC
ACCAGTGCCTGAACATGCCCGTCGCCCAGAGAGGCCCTGGCGATGACTGCCAGAAGTTTGCCGTGGGCAATGTCA
ACTGCGGCTGTGCGCAGAACAACAACAACAACAACAACAACAACAACAACAATAACAACAATAACAACCGAGGCA
ACCAGGGCGGCCAAGGCAACCAGGGCGGCCAGGGCGGTCGAGGTAACCAGGGCGGCCAGGGCAACCAGGGCAACC
AGGGCGGTCGAGGCAACCAGGGCGGCCAGGGCAACCAGGGCAATCAGGGCAACCAGGGCGGTCGAGGCAACCAGG
GCAACCAGGGCGGTCGAGGCAACCAGGGCGGCCAAGGCAATCAGGGCAACCAGGGCGGCCAAGGCAATCAGGGCA
ACAACGCCCAGGACCAGCAGCGTGGCCAGCAGCAGCAGCAGCAACAGATTCAACAGCAGCAACAGCAGCAGATTC
AACAGGCTCGGCAGCAGCAACAAGCCCAGCAGCAGGCAGCAGCCCAGCAGCAGCAGGCGGCAGCCCAGCAGCAGG
GCGGCGGGGGCGGCCAGCGGGGCGGCAATGGCCAACGGGGTGGAAAGCAAGGAGGGCGGAAATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail