Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|2323
Gene name
Locationscaffold_199:373..2916
Strand+
Gene length (bp)2543
Transcript length (bp)2445
Coding sequence length (bp)2442
Protein length (aa) 814

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13639 zf-RING_2 Ring finger domain 9.6E-12 678 722
PF02225 PA PA domain 2.9E-09 192 266
PF13923 zf-C3HC4_2 Zinc finger, C3HC4 type (RING finger) 4.0E-09 678 721
PF12678 zf-rbx1 RING-H2 zinc finger domain 1.1E-08 679 722
PF00097 zf-C3HC4 Zinc finger, C3HC4 type (RING finger) 1.3E-08 679 721
PF17123 zf-RING_11 RING-like zinc finger 1.3E-08 678 707
PF13445 zf-RING_UBOX RING-type zinc-finger 4.5E-05 679 719

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O54965|RNF13_MOUSE E3 ubiquitin-protein ligase RNF13 OS=Mus musculus GN=Rnf13 PE=1 SV=2 679 728 4.0E-11
sp|Q66HG0|RNF13_RAT E3 ubiquitin-protein ligase RNF13 OS=Rattus norvegicus GN=Rnf13 PE=2 SV=1 679 728 5.0E-11
sp|Q90972|RNF13_CHICK E3 ubiquitin-protein ligase RNF13 OS=Gallus gallus GN=RNF13 PE=1 SV=1 679 752 6.0E-11
sp|Q5RCV8|RNF13_PONAB E3 ubiquitin-protein ligase RNF13 OS=Pongo abelii GN=RNF13 PE=2 SV=1 679 728 1.0E-10
sp|O43567|RNF13_HUMAN E3 ubiquitin-protein ligase RNF13 OS=Homo sapiens GN=RNF13 PE=1 SV=1 679 728 1.0E-10
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O54965|RNF13_MOUSE E3 ubiquitin-protein ligase RNF13 OS=Mus musculus GN=Rnf13 PE=1 SV=2 679 728 4.0E-11
sp|Q66HG0|RNF13_RAT E3 ubiquitin-protein ligase RNF13 OS=Rattus norvegicus GN=Rnf13 PE=2 SV=1 679 728 5.0E-11
sp|Q90972|RNF13_CHICK E3 ubiquitin-protein ligase RNF13 OS=Gallus gallus GN=RNF13 PE=1 SV=1 679 752 6.0E-11
sp|Q5RCV8|RNF13_PONAB E3 ubiquitin-protein ligase RNF13 OS=Pongo abelii GN=RNF13 PE=2 SV=1 679 728 1.0E-10
sp|O43567|RNF13_HUMAN E3 ubiquitin-protein ligase RNF13 OS=Homo sapiens GN=RNF13 PE=1 SV=1 679 728 1.0E-10
sp|Q0VD51|RNF13_BOVIN E3 ubiquitin-protein ligase RNF13 OS=Bos taurus GN=RNF13 PE=2 SV=1 679 728 2.0E-10
sp|Q91XF4|RN167_MOUSE E3 ubiquitin-protein ligase RNF167 OS=Mus musculus GN=Rnf167 PE=2 SV=1 679 727 3.0E-10
sp|Q9H6Y7|RN167_HUMAN E3 ubiquitin-protein ligase RNF167 OS=Homo sapiens GN=RNF167 PE=1 SV=1 679 727 3.0E-10
sp|Q5XIL0|RN167_RAT E3 ubiquitin-protein ligase RNF167 OS=Rattus norvegicus GN=Rnf167 PE=2 SV=1 679 727 4.0E-10
sp|P87139|YDM9_SCHPO Uncharacterized RING finger protein C57A7.09 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC57A7.09 PE=1 SV=1 677 725 3.0E-09
sp|O00237|RN103_HUMAN E3 ubiquitin-protein ligase RNF103 OS=Homo sapiens GN=RNF103 PE=1 SV=1 673 722 5.0E-09
sp|Q9EPZ8|RN103_RAT E3 ubiquitin-protein ligase RNF103 OS=Rattus norvegicus GN=Rnf103 PE=2 SV=1 678 722 8.0E-09
sp|Q9R1W3|RN103_MOUSE E3 ubiquitin-protein ligase RNF103 OS=Mus musculus GN=Rnf103 PE=2 SV=2 678 722 8.0E-09
sp|Q9M0R7|ATL39_ARATH RING-H2 finger protein ATL39 OS=Arabidopsis thaliana GN=ATL39 PE=2 SV=1 676 726 1.0E-08
sp|Q9M0R6|ATL35_ARATH Putative RING-H2 finger protein ATL35 OS=Arabidopsis thaliana GN=ATL35 PE=3 SV=1 677 812 1.0E-08
sp|Q7XTV7|HIP1_ORYSJ Probable E3 ubiquitin-protein ligase HIP1 OS=Oryza sativa subsp. japonica GN=HIP1 PE=1 SV=2 667 728 2.0E-08
sp|Q9ZQF9|MBR1_ARATH E3 ubiquitin-protein ligase MBR1 OS=Arabidopsis thaliana GN=MBR1 PE=1 SV=1 679 728 2.0E-08
sp|Q6DIP3|RN126_XENTR E3 ubiquitin-protein ligase RNF126 OS=Xenopus tropicalis GN=rnf126 PE=2 SV=1 670 722 3.0E-08
sp|Q8VZ14|RMR2_ARATH Receptor homology region, transmembrane domain- and RING domain-containing protein 2 OS=Arabidopsis thaliana GN=RMR2 PE=2 SV=1 679 724 4.0E-08
sp|Q6IRP0|R126B_XENLA E3 ubiquitin-protein ligase RNF126-B OS=Xenopus laevis GN=rnf126-b PE=2 SV=1 670 722 4.0E-08
sp|O64763|ATL9_ARATH E3 ubiquitin-protein ligase ATL9 OS=Arabidopsis thaliana GN=ATL9 PE=1 SV=1 677 743 6.0E-08
sp|Q9NVW2|RNF12_HUMAN E3 ubiquitin-protein ligase RLIM OS=Homo sapiens GN=RLIM PE=1 SV=3 679 735 6.0E-08
sp|Q10R93|RMR1_ORYSJ Receptor homology region, transmembrane domain- and RING domain-containing protein 1 OS=Oryza sativa subsp. japonica GN=Os03g0167500 PE=2 SV=1 679 724 6.0E-08
sp|F4I2Y3|RMR3_ARATH Receptor homology region, transmembrane domain- and RING domain-containing protein 3 OS=Arabidopsis thaliana GN=RMR3 PE=3 SV=1 679 737 6.0E-08
sp|Q06003|GOLI_DROME Protein goliath OS=Drosophila melanogaster GN=gol PE=2 SV=3 679 727 7.0E-08
sp|Q8LPN7|RNG1L_ARATH E3 ubiquitin-protein ligase RING1-like OS=Arabidopsis thaliana GN=At3g19950 PE=1 SV=1 678 740 7.0E-08
sp|P87237|YC0C_SCHPO Uncharacterized RING finger protein C4G3.12c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC4G3.12c PE=3 SV=1 634 731 8.0E-08
sp|Q9WTV7|RNF12_MOUSE E3 ubiquitin-protein ligase RLIM OS=Mus musculus GN=Rlim PE=1 SV=2 679 728 9.0E-08
sp|Q6NRX0|RN149_XENLA E3 ubiquitin-protein ligase RNF149 OS=Xenopus laevis GN=rnf149 PE=2 SV=1 679 729 1.0E-07
sp|Q9LUL6|ATL61_ARATH Putative RING-H2 finger protein ATL61 OS=Arabidopsis thaliana GN=ATL61 PE=3 SV=1 677 750 1.0E-07
sp|Q8RXD3|AIP2_ARATH E3 ubiquitin-protein ligase AIP2 OS=Arabidopsis thaliana GN=AIP2 PE=1 SV=1 665 725 1.0E-07
sp|Q8GUU2|RIE1_ARATH E3 ubiquitin protein ligase RIE1 OS=Arabidopsis thaliana GN=RIE1 PE=2 SV=1 670 727 1.0E-07
sp|Q7T0Q3|R126A_XENLA E3 ubiquitin-protein ligase RNF126-A OS=Xenopus laevis GN=rnf126-a PE=2 SV=1 670 722 1.0E-07
sp|Q4R6Y5|ZNRF4_MACFA Zinc/RING finger protein 4 OS=Macaca fascicularis GN=ZNRF4 PE=2 SV=1 667 725 1.0E-07
sp|Q93Z92|RING4_ARATH E3 ubiquitin-protein ligase At4g11680 OS=Arabidopsis thaliana GN=At4g11680 PE=2 SV=1 678 728 2.0E-07
sp|Q69U49|RMR2_ORYSJ Receptor homology region, transmembrane domain- and RING domain-containing protein 2 OS=Oryza sativa subsp. japonica GN=RMR1 PE=2 SV=2 679 724 2.0E-07
sp|Q9LN71|RING1_ARATH E3 ubiquitin-protein ligase At1g12760 OS=Arabidopsis thaliana GN=At1g12760 PE=1 SV=1 678 728 2.0E-07
sp|Q3U2C5|RN149_MOUSE E3 ubiquitin-protein ligase RNF149 OS=Mus musculus GN=Rnf149 PE=1 SV=3 679 729 2.0E-07
sp|Q1MTR5|YG66_SCHPO Uncharacterized RING finger membrane protein C15C4.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC15C4.06c PE=3 SV=1 676 736 2.0E-07
sp|Q8AWW4|RN128_XENLA E3 ubiquitin-protein ligase RNF128 OS=Xenopus laevis GN=rnf128 PE=2 SV=2 679 729 2.0E-07
sp|Q8NC42|RN149_HUMAN E3 ubiquitin-protein ligase RNF149 OS=Homo sapiens GN=RNF149 PE=2 SV=2 678 729 3.0E-07
sp|Q08CG8|RNF44_DANRE RING finger protein 44 OS=Danio rerio GN=rnf44 PE=2 SV=1 664 724 3.0E-07
sp|Q9C7I1|ATL34_ARATH RING-H2 finger protein ATL34 OS=Arabidopsis thaliana GN=ATL34 PE=2 SV=1 677 725 3.0E-07
sp|Q0WPW5|RMR4_ARATH Receptor homology region, transmembrane domain- and RING domain-containing protein 4 OS=Arabidopsis thaliana GN=RMR4 PE=2 SV=1 677 724 3.0E-07
sp|Q8WWF5|ZNRF4_HUMAN Zinc/RING finger protein 4 OS=Homo sapiens GN=ZNRF4 PE=2 SV=3 667 725 5.0E-07
sp|Q8GXF8|SHGR9_ARATH E3 ubiquitin-protein ligase SGR9, amyloplastic OS=Arabidopsis thaliana GN=SGR9 PE=1 SV=1 676 725 6.0E-07
sp|Q9M622|RMR1_ARATH Receptor homology region, transmembrane domain- and RING domain-containing protein 1 OS=Arabidopsis thaliana GN=RMR1 PE=2 SV=1 679 746 6.0E-07
sp|Q3UHJ8|RNF44_MOUSE RING finger protein 44 OS=Mus musculus GN=Rnf44 PE=2 SV=1 672 724 6.0E-07
sp|Q5SSZ7|ZNRF3_MOUSE E3 ubiquitin-protein ligase ZNRF3 OS=Mus musculus GN=Znrf3 PE=1 SV=1 674 727 6.0E-07
sp|Q4V7B8|RNF44_RAT RING finger protein 44 OS=Rattus norvegicus GN=Rnf44 PE=2 SV=1 672 724 7.0E-07
sp|P87119|MU145_SCHPO RING finger protein mug145 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mug145 PE=1 SV=1 679 731 8.0E-07
sp|A5WWA0|ZNRF3_DANRE E3 ubiquitin-protein ligase ZNRF3 OS=Danio rerio GN=znrf3 PE=1 SV=2 679 726 8.0E-07
sp|Q91YL2|RN126_MOUSE E3 ubiquitin-protein ligase RNF126 OS=Mus musculus GN=Rnf126 PE=1 SV=1 670 722 9.0E-07
sp|Q6GQB9|EDEM3_XENLA ER degradation-enhancing alpha-mannosidase-like protein 3 OS=Xenopus laevis GN=edem3 PE=2 SV=2 158 306 9.0E-07
sp|Q9ULT6|ZNRF3_HUMAN E3 ubiquitin-protein ligase ZNRF3 OS=Homo sapiens GN=ZNRF3 PE=1 SV=3 679 726 1.0E-06
sp|Q4KLR8|ZNRF3_XENLA E3 ubiquitin-protein ligase ZNRF3 OS=Xenopus laevis GN=znrf3 PE=2 SV=1 678 727 1.0E-06
sp|Q9M2S6|SDIR1_ARATH E3 ubiquitin-protein ligase SDIR1 OS=Arabidopsis thaliana GN=SDIR1 PE=1 SV=1 668 722 1.0E-06
sp|Q9H0F5|RNF38_HUMAN E3 ubiquitin-protein ligase RNF38 OS=Homo sapiens GN=RNF38 PE=1 SV=4 671 724 1.0E-06
sp|Q9BV68|RN126_HUMAN E3 ubiquitin-protein ligase RNF126 OS=Homo sapiens GN=RNF126 PE=1 SV=1 670 722 2.0E-06
sp|Q9M0R4|ATL37_ARATH Putative RING-H2 finger protein ATL37 OS=Arabidopsis thaliana GN=ATL37 PE=3 SV=1 677 725 2.0E-06
sp|Q08D68|ZNRF3_XENTR E3 ubiquitin-protein ligase ZNRF3 OS=Xenopus tropicalis GN=znrf3 PE=1 SV=1 679 726 2.0E-06
sp|Q8LDB8|RING2_ARATH E3 ubiquitin-protein ligase At1g63170 OS=Arabidopsis thaliana GN=At1g63170 PE=2 SV=2 678 728 3.0E-06
sp|Q6GPV5|RN181_XENLA E3 ubiquitin-protein ligase RNF181 OS=Xenopus laevis GN=rnf181 PE=2 SV=1 677 753 3.0E-06
sp|Q9M0R5|ATL36_ARATH Putative RING-H2 finger protein ATL36 OS=Arabidopsis thaliana GN=ATL36 PE=3 SV=1 677 725 4.0E-06
sp|Q9D0C1|RN115_MOUSE E3 ubiquitin-protein ligase RNF115 OS=Mus musculus GN=Rnf115 PE=1 SV=1 677 722 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0046872 metal ion binding Yes
GO:0008270 zinc ion binding Yes
GO:0046914 transition metal ion binding No
GO:0005488 binding No
GO:0003674 molecular_function No
GO:0043169 cation binding No
GO:0043167 ion binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 24 0.45

Transmembrane Domains

Domain # Start End Length
1 7 26 19
2 542 564 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
SC16a Pure fungal culture 94.08 48.46 139.71
CcL In ants, during behavior modification 47.83 26.05 69.62
CcD In ants, recently dead 37.80 20.49 55.12

Differential expression

Label1 Label2 Q-value Significant difference
SC16a CcL 0.000997 yes
SC16a CcD 0.000286 yes
CcL CcD 0.329462 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|2323
MRPPRIAVLALFLAASIFILGRAFTPTSRPHTSSYPSEARSSRSVFGFMYYNTPFSLFPPNAAISLTDDNSTSFA
ARPAAFGPKLAATGLSGQLWVGSGFAEDIQDGDGELGCSDLPGWGSGNIRAGLRNSFRADMPKSSSSSAGPGHLL
DPDHRESVVTKARPARGVTDHVDARSLSRRDASSAPAHADIQSIQEAAEIQGKIVLLMRGGCGFLEKVMWAQRRG
AVAVIVGDNQKGGPLIQMFAHGDEVENVTVPSVFTARTTAHLLSSLTQPGSFIEDTLDDNGNPVRKVQKGPKKPD
SKTRTLIPGKGPAAASPPTGSLKAKHRRAVKSTSSDPAASRGWLSRLFGWGQTPLVAADKSRPPSSGRRDWVVVD
NWSDESDKVIREGLKRSAKPKSADDKFVIGVHDWRDRHLVDKSAQQIKVSDKVDSKATLGAKSHDQAPSKDAATE
GNGPQGGSITPGSGEYTSSRLASRDGKGSATKGDGNAHSLMSRLFGDDKGDAGRKTHDAESRSGARYHDFAPHEG
LWVTITPTSSASPFFDTLLVLVISPLVTLTVVYALLIVRARIRRRRWRAPKSVVDRLPVRTYRTAVSSPSLSPRL
PSPSGATPTTPLLQHSPTRSRPRSRTTTGVLQSENLLVPSAAVPTPAGPARSGARTEHEKGAGGFSAEWRKYMGR
QVECVVCLEEYVDGVSRVMSLPCGHEFHADCITPWLTTRRRTCPICKGDVVRSLARGARDGPRYEPYNDGSEEDE
EAEASGSRAMDGPSDLERGILSPRLDRESSRTGRHEGWLGLLSSSFGTRTRPRSQSPRQGDRDR
Coding >Ophio5|2323
ATGCGGCCACCCCGCATCGCCGTTCTCGCCCTCTTCCTCGCCGCATCCATCTTCATCCTCGGTCGCGCCTTCACC
CCGACCAGCCGACCACATACCTCGTCGTATCCTTCCGAGGCCCGCTCCTCGCGCTCCGTCTTCGGCTTCATGTAC
TACAATACGCCCTTCTCGCTCTTCCCACCCAACGCTGCCATCAGCTTGACCGACGACAACAGCACCTCGTTTGCC
GCCCGTCCCGCTGCCTTCGGGCCCAAGCTCGCCGCCACCGGCCTGAGCGGCCAGCTGTGGGTCGGCAGCGGTTTC
GCCGAGGATATCCAGGATGGCGATGGCGAGCTGGGATGCAGCGACCTTCCCGGCTGGGGCAGCGGCAATATCAGG
GCCGGCCTCCGAAACTCGTTCCGCGCTGACATGCCCAAGAGCTCGTCCTCTTCCGCCGGCCCCGGCCACCTCCTT
GACCCGGACCACAGGGAGTCCGTCGTCACCAAGGCCCGCCCGGCCCGAGGTGTTACCGACCATGTCGACGCTCGC
TCGCTCTCTCGCCGGGACGCCTCGTCCGCACCGGCCCACGCCGATATTCAATCCATCCAAGAAGCCGCCGAGATC
CAGGGCAAGATCGTGCTACTGATGCGCGGAGGCTGTGGCTTTCTGGAAAAGGTCATGTGGGCCCAGCGGCGAGGC
GCCGTTGCCGTCATCGTCGGCGACAATCAAAAGGGCGGGCCGCTCATCCAGATGTTTGCCCACGGCGACGAGGTC
GAGAATGTGACGGTGCCCTCCGTCTTCACCGCCCGCACCACGGCTCATCTTCTGTCGTCGTTGACGCAGCCCGGA
AGCTTCATCGAGGATACCCTCGACGACAACGGCAACCCCGTTCGCAAGGTTCAGAAGGGCCCCAAGAAGCCCGAC
AGCAAGACGCGCACCCTGATCCCCGGCAAGGGACCGGCCGCCGCCTCGCCACCTACCGGCTCCTTGAAGGCCAAG
CATAGGAGAGCCGTCAAGTCGACGTCGAGCGATCCGGCGGCAAGCCGCGGTTGGCTGTCGAGATTGTTCGGCTGG
GGCCAGACGCCTCTCGTTGCTGCCGACAAGAGCCGACCGCCGAGCAGCGGACGCCGCGACTGGGTCGTCGTCGAC
AACTGGAGCGACGAATCGGACAAGGTCATTAGGGAGGGTCTGAAACGGTCGGCCAAGCCCAAGTCGGCCGACGAC
AAATTCGTCATCGGCGTGCACGACTGGCGAGACCGCCATCTCGTCGATAAGTCGGCGCAGCAGATCAAGGTCTCC
GACAAGGTCGACTCCAAGGCGACATTAGGCGCCAAATCCCACGACCAGGCGCCGAGCAAGGATGCCGCCACCGAA
GGCAACGGTCCCCAGGGCGGCAGCATCACTCCTGGAAGCGGCGAGTACACTTCGTCCCGATTGGCGTCGAGGGAC
GGCAAGGGGTCGGCCACAAAAGGCGACGGCAACGCTCACAGCCTCATGTCGAGGCTCTTCGGTGACGACAAGGGC
GACGCCGGCAGGAAGACGCATGACGCCGAGAGCCGGTCCGGCGCCCGCTACCACGACTTCGCACCGCACGAGGGT
CTCTGGGTCACCATCACACCAACGAGCAGCGCCAGCCCATTCTTCGACACGCTGCTCGTGCTCGTCATCAGCCCG
CTGGTTACGCTGACCGTCGTCTACGCGCTCCTCATCGTCCGCGCCCGGATCCGCCGGAGGAGGTGGAGGGCACCC
AAGTCGGTCGTCGACCGTCTGCCGGTACGGACATACCGCACGGCAGTGTCGTCTCCCAGCCTGTCCCCGAGGCTT
CCCTCGCCCTCGGGCGCTACGCCGACGACGCCGCTGCTCCAACACAGCCCTACGCGGTCACGGCCGCGATCGAGG
ACCACGACCGGGGTTCTACAGAGCGAGAATCTGCTGGTGCCGAGCGCCGCCGTCCCGACGCCGGCGGGGCCCGCC
AGAAGCGGTGCGCGAACCGAGCACGAGAAGGGCGCCGGAGGCTTCTCTGCCGAGTGGAGGAAGTACATGGGAAGG
CAGGTCGAGTGCGTCGTGTGTCTGGAGGAGTACGTCGACGGCGTGAGCAGGGTGATGAGCCTGCCCTGCGGCCAC
GAATTCCACGCCGACTGCATAACCCCGTGGCTGACGACACGCCGACGGACATGCCCTATCTGCAAGGGGGACGTT
GTCCGATCCCTGGCCCGCGGCGCGCGCGACGGCCCCCGCTACGAGCCCTACAACGACGGCAGCGAGGAAGACGAG
GAAGCCGAGGCCTCGGGCTCCCGCGCAATGGACGGTCCTTCGGACCTGGAGCGGGGCATCCTCTCGCCCAGACTG
GACCGGGAATCCTCTAGAACAGGCCGACACGAAGGCTGGCTGGGGTTGCTGTCCAGCAGCTTCGGCACCCGGACG
AGGCCACGATCCCAATCGCCTCGGCAGGGGGATCGTGACCGG
Transcript >Ophio5|2323
ATGCGGCCACCCCGCATCGCCGTTCTCGCCCTCTTCCTCGCCGCATCCATCTTCATCCTCGGTCGCGCCTTCACC
CCGACCAGCCGACCACATACCTCGTCGTATCCTTCCGAGGCCCGCTCCTCGCGCTCCGTCTTCGGCTTCATGTAC
TACAATACGCCCTTCTCGCTCTTCCCACCCAACGCTGCCATCAGCTTGACCGACGACAACAGCACCTCGTTTGCC
GCCCGTCCCGCTGCCTTCGGGCCCAAGCTCGCCGCCACCGGCCTGAGCGGCCAGCTGTGGGTCGGCAGCGGTTTC
GCCGAGGATATCCAGGATGGCGATGGCGAGCTGGGATGCAGCGACCTTCCCGGCTGGGGCAGCGGCAATATCAGG
GCCGGCCTCCGAAACTCGTTCCGCGCTGACATGCCCAAGAGCTCGTCCTCTTCCGCCGGCCCCGGCCACCTCCTT
GACCCGGACCACAGGGAGTCCGTCGTCACCAAGGCCCGCCCGGCCCGAGGTGTTACCGACCATGTCGACGCTCGC
TCGCTCTCTCGCCGGGACGCCTCGTCCGCACCGGCCCACGCCGATATTCAATCCATCCAAGAAGCCGCCGAGATC
CAGGGCAAGATCGTGCTACTGATGCGCGGAGGCTGTGGCTTTCTGGAAAAGGTCATGTGGGCCCAGCGGCGAGGC
GCCGTTGCCGTCATCGTCGGCGACAATCAAAAGGGCGGGCCGCTCATCCAGATGTTTGCCCACGGCGACGAGGTC
GAGAATGTGACGGTGCCCTCCGTCTTCACCGCCCGCACCACGGCTCATCTTCTGTCGTCGTTGACGCAGCCCGGA
AGCTTCATCGAGGATACCCTCGACGACAACGGCAACCCCGTTCGCAAGGTTCAGAAGGGCCCCAAGAAGCCCGAC
AGCAAGACGCGCACCCTGATCCCCGGCAAGGGACCGGCCGCCGCCTCGCCACCTACCGGCTCCTTGAAGGCCAAG
CATAGGAGAGCCGTCAAGTCGACGTCGAGCGATCCGGCGGCAAGCCGCGGTTGGCTGTCGAGATTGTTCGGCTGG
GGCCAGACGCCTCTCGTTGCTGCCGACAAGAGCCGACCGCCGAGCAGCGGACGCCGCGACTGGGTCGTCGTCGAC
AACTGGAGCGACGAATCGGACAAGGTCATTAGGGAGGGTCTGAAACGGTCGGCCAAGCCCAAGTCGGCCGACGAC
AAATTCGTCATCGGCGTGCACGACTGGCGAGACCGCCATCTCGTCGATAAGTCGGCGCAGCAGATCAAGGTCTCC
GACAAGGTCGACTCCAAGGCGACATTAGGCGCCAAATCCCACGACCAGGCGCCGAGCAAGGATGCCGCCACCGAA
GGCAACGGTCCCCAGGGCGGCAGCATCACTCCTGGAAGCGGCGAGTACACTTCGTCCCGATTGGCGTCGAGGGAC
GGCAAGGGGTCGGCCACAAAAGGCGACGGCAACGCTCACAGCCTCATGTCGAGGCTCTTCGGTGACGACAAGGGC
GACGCCGGCAGGAAGACGCATGACGCCGAGAGCCGGTCCGGCGCCCGCTACCACGACTTCGCACCGCACGAGGGT
CTCTGGGTCACCATCACACCAACGAGCAGCGCCAGCCCATTCTTCGACACGCTGCTCGTGCTCGTCATCAGCCCG
CTGGTTACGCTGACCGTCGTCTACGCGCTCCTCATCGTCCGCGCCCGGATCCGCCGGAGGAGGTGGAGGGCACCC
AAGTCGGTCGTCGACCGTCTGCCGGTACGGACATACCGCACGGCAGTGTCGTCTCCCAGCCTGTCCCCGAGGCTT
CCCTCGCCCTCGGGCGCTACGCCGACGACGCCGCTGCTCCAACACAGCCCTACGCGGTCACGGCCGCGATCGAGG
ACCACGACCGGGGTTCTACAGAGCGAGAATCTGCTGGTGCCGAGCGCCGCCGTCCCGACGCCGGCGGGGCCCGCC
AGAAGCGGTGCGCGAACCGAGCACGAGAAGGGCGCCGGAGGCTTCTCTGCCGAGTGGAGGAAGTACATGGGAAGG
CAGGTCGAGTGCGTCGTGTGTCTGGAGGAGTACGTCGACGGCGTGAGCAGGGTGATGAGCCTGCCCTGCGGCCAC
GAATTCCACGCCGACTGCATAACCCCGTGGCTGACGACACGCCGACGGACATGCCCTATCTGCAAGGGGGACGTT
GTCCGATCCCTGGCCCGCGGCGCGCGCGACGGCCCCCGCTACGAGCCCTACAACGACGGCAGCGAGGAAGACGAG
GAAGCCGAGGCCTCGGGCTCCCGCGCAATGGACGGTCCTTCGGACCTGGAGCGGGGCATCCTCTCGCCCAGACTG
GACCGGGAATCCTCTAGAACAGGCCGACACGAAGGCTGGCTGGGGTTGCTGTCCAGCAGCTTCGGCACCCGGACG
AGGCCACGATCCCAATCGCCTCGGCAGGGGGATCGTGACCGGTGA
Gene >Ophio5|2323
ATGCGGCCACCCCGCATCGCCGTTCTCGCCCTCTTCCTCGCCGCATCCATCTTCATCCTCGGTCGCGCCTTCACC
CCGACCAGCCGACCACATACCTCGTCGTATCCTTCCGAGGCCCGCTCCTCGCGCTCCGTCTTCGGCTTCATGTAC
TACAATACGCCCTTCTCGCTCTTCCCACCCAACGCTGCCATCAGCTTGACCGACGACAACAGCACCTCGTTTGCC
GCCCGTCCCGCTGCCTTCGGGCCCAAGCTCGCCGCCACCGGCCTGAGCGGCCAGCTGTGGGTCGGCAGCGGTTTC
GCCGAGGATATCCAGGATGGCGATGGCGAGCTGGGATGCAGCGACCTTCCCGGCTGGGGCAGCGGCAATATCAGG
GCCGGCCTCCGAAACTCGTTCCGCGCTGACATGCCCAAGAGCTCGTCCTCTTCCGCCGGCCCCGGCCACCTCCTT
GACCCGGACCACAGGGAGTCCGTCGTCACCAAGGCCCGCCCGGCCCGAGGTGTTACCGACCATGTCGACGCTCGC
TCGCTCTCTCGCCGGGACGCCTCGTCCGCACCGGCCCACGCCGATATTCAATCCATCCAAGAAGCCGCCGAGATC
CAGGGCAAGATCGTGCTACTGATGCGCGGAGGCTGTGGCTTTCTGGAAAAGGTCATGTGGGCCCAGCGGCGAGGC
GCCGTTGCCGTCATCGTCGGCGACAATCAAAAGGGCGGGCCGCTCATCCAGATGTTTGCCCACGGCGACGAGGTC
GAGAATGTGACGGTGCCCTCCGTCTTCACCGCCCGCACCACGGCTCATCTTCTGTCGTCGTTGACGCAGCCCGGA
AGCTTCATCGAGGATACCCTCGACGACAACGGCAACCCCGTTCGCAAGGTTCAGAAGGGCCCCAAGAAGCCCGAC
AGCAAGACGCGCACCCTGATCCCCGGCAAGGGACCGGCCGCCGCCTCGCCACCTACCGGCTCCTTGAAGGCCAAG
CATAGGAGAGCCGTCAAGTCGACGTCGAGCGATCCGGCGGCAAGCCGCGGTTGGCTGTCGAGATTGTTCGGCTGG
GGCCAGACGCCTCTCGTTGCTGCCGACAAGAGCCGACCGCCGAGCAGCGGACGCCGCGACTGGGTCGTCGTCGAC
AACTGGAGCGACGAATCGGACAAGGTCATTAGGGAGGGTCTGAAACGGTCGGCCAAGCCCAAGTCGGCCGACGAC
AAATTCGTCATCGGCGTGCACGACTGGCGAGACCGCCATCTCGTCGATAAGTCGGCGCAGCAGATCAAGGTCTCC
GACAAGGTCGACTCCAAGGCGACATTAGGCGCCAAATCCCACGACCAGGCGCCGAGCAAGGATGCCGCCACCGAA
GGCAACGGTCCCCAGGGCGGCAGCATCACTCCTGGAAGCGGCGAGTACACTTCGTCCCGATTGGCGTCGAGGGAC
GGCAAGGGGTCGGCCACAAAAGGCGACGGCAACGCTCACAGCCTCATGTCGAGGCTCTTCGGTGACGACAAGGGC
GACGCCGGCAGGAAGACGCATGACGCCGAGAGCCGGTCCGGCGCCCGCTACCACGACTTCGCACCGCACGAGGGT
CTCTGGGTCACCATCACACCAACGAGCAGCGCCAGCCCATTCTTCGACACGCTGCTCGTGCTCGTCATCAGCCCG
CTGGTTACGCTGACCGTCGTCTACGCGCTCCTCATCGTCCGCGCCCGGATCCGCCGGAGGAGGTGGAGGGCACCC
AAGTCGGTCGTCGACCGTCTGCCGGTACGGACATACCGCACGGCAGTGTCGTCTCCCAGCCTGTCCCCGAGGCTT
CCCTCGCCCTCGGGCGCTACGCCGACGACGCCGCTGCTCCAACACAGCCCTACGCGGTCACGGCCGCGATCGAGG
ACCACGACCGGGGTTCTACAGAGCGAGAATCTGCTGGTGCCGAGCGCCGCCGTCCCGACGCCGGCGGGGCCCGCC
AGAAGCGGTGCGCGAACCGAGCACGAGAAGGGCGCCGGAGGCTTCTCTGCCGAGTGGAGGAAGTACATGGGAAGG
CAGGTCGAGTGCGTCGTGTGTCTGGAGGAGTACGTCGACGGCGTGAGCAGGGTGATGAGCCTGCCCTGCGGCCAC
GAATTCCACGCCGACTGCATGTGAGTCTGACCCCACCCCTTGTGGCGCTTTCGCCCTTTACGTCCCCCCCCCCCC
CGCGCATCCGTAAAGACTCGGGACTGACGGCGTCACAACGCAGAACCCCGTGGCTGACGACACGCCGACGGACAT
GCCCTATCTGCAAGGGGGACGTTGTCCGATCCCTGGCCCGCGGCGCGCGCGACGGCCCCCGCTACGAGCCCTACA
ACGACGGCAGCGAGGAAGACGAGGAAGCCGAGGCCTCGGGCTCCCGCGCAATGGACGGTCCTTCGGACCTGGAGC
GGGGCATCCTCTCGCCCAGACTGGACCGGGAATCCTCTAGAACAGGCCGACACGAAGGCTGGCTGGGGTTGCTGT
CCAGCAGCTTCGGCACCCGGACGAGGCCACGATCCCAATCGCCTCGGCAGGGGGATCGTGACCGGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail