Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|2320
Gene name
Locationscaffold_198:25192..25705
Strand+
Gene length (bp)513
Transcript length (bp)270
Coding sequence length (bp)267
Protein length (aa) 89

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07297 DPM2 Dolichol phosphate-mannose biosynthesis regulatory protein (DPM2) 4.6E-32 3 76

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q556K9|DPM2_DICDI Dolichol phosphate-mannose biosynthesis regulatory protein OS=Dictyostelium discoideum GN=dpm2-1 PE=3 SV=1 3 77 3.0E-17
sp|Q9USW6|DPM2_SCHPO Dolichol phosphate-mannose biosynthesis regulatory protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dpm2 PE=3 SV=1 14 78 7.0E-15
sp|Q2KIN1|DPM2_BOVIN Dolichol phosphate-mannose biosynthesis regulatory protein OS=Bos taurus GN=DPM2 PE=3 SV=3 3 75 1.0E-12
sp|O94777|DPM2_HUMAN Dolichol phosphate-mannose biosynthesis regulatory protein OS=Homo sapiens GN=DPM2 PE=1 SV=3 3 78 3.0E-12
sp|Q9Z1P1|DPM2_CRIGR Dolichol phosphate-mannose biosynthesis regulatory protein OS=Cricetulus griseus GN=DPM2 PE=3 SV=3 3 78 9.0E-12
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q556K9|DPM2_DICDI Dolichol phosphate-mannose biosynthesis regulatory protein OS=Dictyostelium discoideum GN=dpm2-1 PE=3 SV=1 3 77 3.0E-17
sp|Q9USW6|DPM2_SCHPO Dolichol phosphate-mannose biosynthesis regulatory protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dpm2 PE=3 SV=1 14 78 7.0E-15
sp|Q2KIN1|DPM2_BOVIN Dolichol phosphate-mannose biosynthesis regulatory protein OS=Bos taurus GN=DPM2 PE=3 SV=3 3 75 1.0E-12
sp|O94777|DPM2_HUMAN Dolichol phosphate-mannose biosynthesis regulatory protein OS=Homo sapiens GN=DPM2 PE=1 SV=3 3 78 3.0E-12
sp|Q9Z1P1|DPM2_CRIGR Dolichol phosphate-mannose biosynthesis regulatory protein OS=Cricetulus griseus GN=DPM2 PE=3 SV=3 3 78 9.0E-12
sp|Q9Z324|DPM2_MOUSE Dolichol phosphate-mannose biosynthesis regulatory protein OS=Mus musculus GN=Dpm2 PE=3 SV=3 3 78 6.0E-09
sp|Q9Z325|DPM2_RAT Dolichol phosphate-mannose biosynthesis regulatory protein OS=Rattus norvegicus GN=Dpm2 PE=1 SV=3 3 47 1.0E-08
sp|Q2V2P5|YI102_YEAST Uncharacterized protein YIL102C-A OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YIL102C-A PE=4 SV=1 12 77 4.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0030176 integral component of endoplasmic reticulum membrane Yes
GO:0030234 enzyme regulator activity Yes
GO:0019348 dolichol metabolic process Yes
GO:0071704 organic substance metabolic process No
GO:0044255 cellular lipid metabolic process No
GO:0008150 biological_process No
GO:0044238 primary metabolic process No
GO:0031224 intrinsic component of membrane No
GO:0031227 intrinsic component of endoplasmic reticulum membrane No
GO:0031300 intrinsic component of organelle membrane No
GO:0016021 integral component of membrane No
GO:0044281 small molecule metabolic process No
GO:0008152 metabolic process No
GO:0044237 cellular metabolic process No
GO:0003674 molecular_function No
GO:0006720 isoprenoid metabolic process No
GO:0031301 integral component of organelle membrane No
GO:0110165 cellular anatomical entity No
GO:0009987 cellular process No
GO:0006066 alcohol metabolic process No
GO:0098772 molecular function regulator activity No
GO:0005575 cellular_component No
GO:0006629 lipid metabolic process No
GO:1901615 organic hydroxy compound metabolic process No
GO:0016093 polyprenol metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.5

Transmembrane Domains

Domain # Start End Length
1 5 27 22
2 47 69 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|2320
MLDKLLGLAMLVAASVVFIYYSVWTLLMPFVDDDHPLQNFFLPRVWAIRIPVILVLLASAVVGSFLGTVMIRSNR
KKAFKAKAAAKKKA
Coding >Ophio5|2320
ATGCTCGACAAACTCTTGGGCCTCGCCATGCTCGTGGCTGCCTCCGTCGTCTTCATCTACTATTCCGTCTGGACC
CTCCTCATGCCCTTCGTCGACGATGATCACCCCCTTCAGAACTTCTTCCTCCCCCGCGTCTGGGCCATCCGAATC
CCCGTCATCCTCGTCCTCCTCGCCTCGGCCGTCGTCGGCTCCTTCCTCGGCACCGTCATGATTCGGAGCAACCGT
AAGAAGGCCTTCAAAGCCAAGGCCGCCGCCAAGAAGAAGGCG
Transcript >Ophio5|2320
ATGCTCGACAAACTCTTGGGCCTCGCCATGCTCGTGGCTGCCTCCGTCGTCTTCATCTACTATTCCGTCTGGACC
CTCCTCATGCCCTTCGTCGACGATGATCACCCCCTTCAGAACTTCTTCCTCCCCCGCGTCTGGGCCATCCGAATC
CCCGTCATCCTCGTCCTCCTCGCCTCGGCCGTCGTCGGCTCCTTCCTCGGCACCGTCATGATTCGGAGCAACCGT
AAGAAGGCCTTCAAAGCCAAGGCCGCCGCCAAGAAGAAGGCGTGA
Gene >Ophio5|2320
ATGGTCGCGATCCCCTCCCCCACCCCCTCCCCGGGAAGAAAAACCAACCTCTCCATCTCTCCTAGCTCTCCTTCT
CCACGCCGTTGAAGGGGCCCGATACTGACATTCTCTCCTTTCCCCCCCAATCACCACAGCTCGACAAACTCTTGG
GCCTCGCCATGCTCGTGGCTGCCTCCGTCGTCTTCATCTACTATTCCGTCTGGACCCTCCTCATGGTTCGCTCTT
CCCCCTCTCCCCTGCCCCCTTTCCCTGTCCAACGTTTTTTTTTTTTTCACACCCCCTTATCTTCTTCTTCTTCAC
GCGCCCAATGCTAACCAACGCGCTCAGCCCTTCGTCGACGATGATCACCCCCTTCAGAACTTCTTCCTCCCCCGC
GTCTGGGCCATCCGAATCCCCGTCATCCTCGTCCTCCTCGCCTCGGCCGTCGTCGGCTCCTTCCTCGGCACCGTC
ATGATTCGGAGCAACCGTAAGAAGGCCTTCAAAGCCAAGGCCGCCGCCAAGAAGAAGGCGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail