Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|230
Gene name
Locationscaffold_1042:2318..3484
Strand-
Gene length (bp)1166
Transcript length (bp)780
Coding sequence length (bp)777
Protein length (aa) 259

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02517 Rce1-like Type II CAAX prenyl endopeptidase Rce1-like 4.6E-13 156 257

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O94448|RCE1_SCHPO Probable CAAX prenyl protease 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1687.02 PE=3 SV=1 17 256 2.0E-31
sp|Q9U1H8|FACE2_DROME CAAX prenyl protease 2 OS=Drosophila melanogaster GN=Sras PE=2 SV=3 42 256 1.0E-20
sp|P57791|FACE2_MOUSE CAAX prenyl protease 2 OS=Mus musculus GN=Rce1 PE=2 SV=1 47 257 6.0E-20
sp|Q9Y256|FACE2_HUMAN CAAX prenyl protease 2 OS=Homo sapiens GN=RCE1 PE=1 SV=1 47 257 3.0E-19
sp|Q8GW19|FACE2_ARATH CAAX prenyl protease 2 OS=Arabidopsis thaliana GN=FACE2 PE=2 SV=2 153 256 5.0E-19
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O94448|RCE1_SCHPO Probable CAAX prenyl protease 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1687.02 PE=3 SV=1 17 256 2.0E-31
sp|Q9U1H8|FACE2_DROME CAAX prenyl protease 2 OS=Drosophila melanogaster GN=Sras PE=2 SV=3 42 256 1.0E-20
sp|P57791|FACE2_MOUSE CAAX prenyl protease 2 OS=Mus musculus GN=Rce1 PE=2 SV=1 47 257 6.0E-20
sp|Q9Y256|FACE2_HUMAN CAAX prenyl protease 2 OS=Homo sapiens GN=RCE1 PE=1 SV=1 47 257 3.0E-19
sp|Q8GW19|FACE2_ARATH CAAX prenyl protease 2 OS=Arabidopsis thaliana GN=FACE2 PE=2 SV=2 153 256 5.0E-19
sp|Q03530|RCE1_YEAST CAAX prenyl protease 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RCE1 PE=1 SV=1 21 256 1.0E-11
sp|G5EEP3|FACE2_CAEEL CAAX prenyl protease 2 homolog OS=Caenorhabditis elegans GN=fce-2 PE=2 SV=1 46 256 4.0E-09
sp|A6H7A0|FACE2_BOVIN CAAX prenyl protease 2 OS=Bos taurus GN=RCE1 PE=2 SV=1 47 208 2.0E-08
sp|B0BMW8|FACE2_RAT CAAX prenyl protease 2 OS=Rattus norvegicus GN=Rce1 PE=2 SV=1 47 208 6.0E-08
[Show less]

GO

GO Term Description Terminal node
GO:0071586 CAAX-box protein processing Yes
GO:0004222 metalloendopeptidase activity Yes
GO:0016020 membrane Yes
GO:0043170 macromolecule metabolic process No
GO:0004175 endopeptidase activity No
GO:0008150 biological_process No
GO:1901564 organonitrogen compound metabolic process No
GO:0044238 primary metabolic process No
GO:0006508 proteolysis No
GO:0008152 metabolic process No
GO:0003674 molecular_function No
GO:0008233 peptidase activity No
GO:0071704 organic substance metabolic process No
GO:0140096 catalytic activity, acting on a protein No
GO:0110165 cellular anatomical entity No
GO:0016787 hydrolase activity No
GO:0008237 metallopeptidase activity No
GO:0019538 protein metabolic process No
GO:0005575 cellular_component No
GO:0016485 protein processing No
GO:0051604 protein maturation No
GO:0006807 nitrogen compound metabolic process No
GO:0003824 catalytic activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 19 0.5

Transmembrane Domains

Domain # Start End Length
1 15 37 22
2 57 79 22
3 117 139 22
4 234 256 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
SC16a Pure fungal culture 132.00 72.95 191.06
CcL In ants, during behavior modification 107.12 58.05 156.19
CcD In ants, recently dead 83.04 44.04 122.04

Differential expression

Label1 Label2 Q-value Significant difference
SC16a CcL 0.385229 no
SC16a CcD 0.034007 yes
CcL CcD 0.288881 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|230
MSLAYFYSWHTGLSKAQAYGLLLGYCAIYVLPLHSLLAAKLSPSRSRDDPKVIRARVRAVSFSTTACSLITFFIL
RQTIPVSDSRPGSASGLPSLGSQSVLHLMGCWPPGLLETAKASLLTVFLFAGPIFECLFLDGVWKQWLRLAPLQR
LWNDWPTWRNTVVGPVTEEFLFRSAAVPLLLLADADLKSIIFRSPLVFGLAHVHHFYEFRISQPYTPVSAAIARS
AFQFSYTSIFGIYATFIFLRTGSLLAVICVHTTR
Coding >Ophio5|230
ATGTCTTTGGCATATTTCTACTCTTGGCACACCGGCCTGAGCAAGGCACAAGCGTACGGCCTACTGTTGGGCTAT
TGCGCCATCTACGTCTTACCACTACACAGTCTATTGGCTGCCAAGCTCTCACCATCACGATCCAGAGATGACCCC
AAAGTAATTCGGGCTAGAGTGCGTGCAGTGTCTTTCTCAACGACGGCGTGCTCTCTTATTACTTTCTTTATTCTC
CGGCAGACCATCCCGGTCTCCGACTCTCGGCCGGGTTCTGCTTCGGGGCTTCCAAGTCTCGGCTCACAGTCTGTC
TTGCATCTCATGGGATGCTGGCCGCCGGGCCTACTCGAGACCGCCAAAGCCTCACTCCTTACTGTTTTTCTCTTC
GCTGGCCCTATATTCGAGTGCTTATTTTTGGATGGGGTATGGAAGCAGTGGCTGCGGCTCGCACCCCTGCAGCGT
CTTTGGAACGACTGGCCAACTTGGCGAAATACTGTTGTTGGCCCGGTCACTGAGGAGTTTCTCTTCCGCTCCGCT
GCTGTACCTTTACTACTACTCGCAGATGCTGACTTGAAAAGCATCATTTTTCGGTCCCCCTTGGTATTTGGCCTT
GCCCATGTCCATCATTTCTACGAGTTTCGCATCAGTCAACCCTACACACCTGTTTCTGCCGCCATAGCCCGCTCT
GCCTTCCAGTTTTCTTACACAAGCATTTTTGGCATCTACGCTACCTTCATTTTTTTGCGTACAGGGTCTCTCCTG
GCTGTCATCTGCGTACATACGACCCGA
Transcript >Ophio5|230
ATGTCTTTGGCATATTTCTACTCTTGGCACACCGGCCTGAGCAAGGCACAAGCGTACGGCCTACTGTTGGGCTAT
TGCGCCATCTACGTCTTACCACTACACAGTCTATTGGCTGCCAAGCTCTCACCATCACGATCCAGAGATGACCCC
AAAGTAATTCGGGCTAGAGTGCGTGCAGTGTCTTTCTCAACGACGGCGTGCTCTCTTATTACTTTCTTTATTCTC
CGGCAGACCATCCCGGTCTCCGACTCTCGGCCGGGTTCTGCTTCGGGGCTTCCAAGTCTCGGCTCACAGTCTGTC
TTGCATCTCATGGGATGCTGGCCGCCGGGCCTACTCGAGACCGCCAAAGCCTCACTCCTTACTGTTTTTCTCTTC
GCTGGCCCTATATTCGAGTGCTTATTTTTGGATGGGGTATGGAAGCAGTGGCTGCGGCTCGCACCCCTGCAGCGT
CTTTGGAACGACTGGCCAACTTGGCGAAATACTGTTGTTGGCCCGGTCACTGAGGAGTTTCTCTTCCGCTCCGCT
GCTGTACCTTTACTACTACTCGCAGATGCTGACTTGAAAAGCATCATTTTTCGGTCCCCCTTGGTATTTGGCCTT
GCCCATGTCCATCATTTCTACGAGTTTCGCATCAGTCAACCCTACACACCTGTTTCTGCCGCCATAGCCCGCTCT
GCCTTCCAGTTTTCTTACACAAGCATTTTTGGCATCTACGCTACCTTCATTTTTTTGCGTACAGGGTCTCTCCTG
GCTGTCATCTGCGTACATACGACCCGATAA
Gene >Ophio5|230
ATGTCTTTGGCATATTTCTACTCTTGGCACACCGGCCTGAGCAAGGCACAAGCGTACGGCCTACTGGTAAGTCCG
TTTCATCATCGAAGCCTAGTAACGGCCAGGGGTAGCCAGAGTAAAGCAAGGCAAGGTGAATGGCCACGATGGGTA
GCTCGGACAGCGGTTTGCTTGTCACCTGATGAGCCCGGACGTTTCTTTTGCTCGATTATACGGAGACGAAGTTTA
GGCTTCATACCTCGTGTTGCACTTCCCAATATGGCCAGTCAAGCAGTTCGTGATAGCTAATCTTTTACAAAGTTG
GGCTATTGCGCCATCTACGTCTTACCACTACACAGTCTATTGGCTGCCAAGCTCTCACCATCACGATCCAGAGAT
GACCCCAAAGTAATTCGGGCTAGAGTGCGTGCAGTGTCTTTCTCAACGACGGCGTGCTCTCTTATTACTTTCTTT
ATTCTCCGGCAGACCATCCCGGTCTCCGACTCTCGGCCGGGTTCTGCTTCGGGGCTTCCAAGTCTCGGCTCACAG
TCTGTCTTGCATCTCATGGGATGCTGGCCGCCGGGCCTACTCGAGACCGCCAAAGCCTCACTCCTTACTGTTTTT
CTCTTCGCTGGCCCTATATTCGAGTGCTTATTTTTGGATGGGGTATGGAAGCAGTGGCTGCGGCTCGCACCCCTG
CAGCGTCTTTGGAACGACTGGCCAACTTGGCGAAATACTGTTGTTGTAGGTTCATGTCGTTGCTATCAGATCGTG
CATGTTGCTAATGCTACCTTCTTTTCAACGTGTTGTTACTGATGAGTGCTCCTCTAGGGCCCGGTCACTGAGGAG
TTTCTCTTCCGCTCCGCTGCTGTACCTTTACTACTACTCGCAGATGCTGACTTGAAAAGCATCATTTTTCGGTCC
CCCTTGGTATTTGGCCTTGCCCATGTCCATCATTTCTACGAGTTTCGCATCAGTCAACCCTACACACCTGTTTCT
GCCGCCATAGCCCGCTCTGCCTTCCAGTTTTCTTACACAAGCATTTTTGGCATCTACGCTACCTTCATTTTTTTG
CGTACAGGGTCTCTCCTGGCTGTCATCTGCGTACATACGGTATGCAATTCTCTGGGACTTCCAAGGGTTTGGGGC
TTTGTAGAGCCATACTGGTTGTCTTGTGACAGACCCGATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail