Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|230
Gene name
Locationscaffold_1042:2318..3484
Strand-
Gene length (bp)1166
Transcript length (bp)780
Coding sequence length (bp)777
Protein length (aa) 259

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02517 Rce1-like Type II CAAX prenyl endopeptidase Rce1-like 4.6E-13 156 257

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O94448|RCE1_SCHPO Probable CAAX prenyl protease 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1687.02 PE=3 SV=1 17 256 2.0E-31
sp|Q9U1H8|FACE2_DROME CAAX prenyl protease 2 OS=Drosophila melanogaster GN=Sras PE=2 SV=3 42 256 1.0E-20
sp|P57791|FACE2_MOUSE CAAX prenyl protease 2 OS=Mus musculus GN=Rce1 PE=2 SV=1 47 257 6.0E-20
sp|Q9Y256|FACE2_HUMAN CAAX prenyl protease 2 OS=Homo sapiens GN=RCE1 PE=1 SV=1 47 257 3.0E-19
sp|Q8GW19|FACE2_ARATH CAAX prenyl protease 2 OS=Arabidopsis thaliana GN=FACE2 PE=2 SV=2 153 256 5.0E-19
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O94448|RCE1_SCHPO Probable CAAX prenyl protease 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1687.02 PE=3 SV=1 17 256 2.0E-31
sp|Q9U1H8|FACE2_DROME CAAX prenyl protease 2 OS=Drosophila melanogaster GN=Sras PE=2 SV=3 42 256 1.0E-20
sp|P57791|FACE2_MOUSE CAAX prenyl protease 2 OS=Mus musculus GN=Rce1 PE=2 SV=1 47 257 6.0E-20
sp|Q9Y256|FACE2_HUMAN CAAX prenyl protease 2 OS=Homo sapiens GN=RCE1 PE=1 SV=1 47 257 3.0E-19
sp|Q8GW19|FACE2_ARATH CAAX prenyl protease 2 OS=Arabidopsis thaliana GN=FACE2 PE=2 SV=2 153 256 5.0E-19
sp|Q03530|RCE1_YEAST CAAX prenyl protease 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RCE1 PE=1 SV=1 21 256 1.0E-11
sp|G5EEP3|FACE2_CAEEL CAAX prenyl protease 2 homolog OS=Caenorhabditis elegans GN=fce-2 PE=2 SV=1 46 256 4.0E-09
sp|A6H7A0|FACE2_BOVIN CAAX prenyl protease 2 OS=Bos taurus GN=RCE1 PE=2 SV=1 47 208 2.0E-08
sp|B0BMW8|FACE2_RAT CAAX prenyl protease 2 OS=Rattus norvegicus GN=Rce1 PE=2 SV=1 47 208 6.0E-08
[Show less]

GO

GO Term Description Terminal node
GO:0071586 CAAX-box protein processing Yes
GO:0004222 metalloendopeptidase activity Yes
GO:0016020 membrane Yes
GO:0043170 macromolecule metabolic process No
GO:0004175 endopeptidase activity No
GO:0008150 biological_process No
GO:1901564 organonitrogen compound metabolic process No
GO:0044238 primary metabolic process No
GO:0006508 proteolysis No
GO:0008152 metabolic process No
GO:0003674 molecular_function No
GO:0008233 peptidase activity No
GO:0071704 organic substance metabolic process No
GO:0140096 catalytic activity, acting on a protein No
GO:0110165 cellular anatomical entity No
GO:0016787 hydrolase activity No
GO:0008237 metallopeptidase activity No
GO:0019538 protein metabolic process No
GO:0005575 cellular_component No
GO:0016485 protein processing No
GO:0051604 protein maturation No
GO:0006807 nitrogen compound metabolic process No
GO:0003824 catalytic activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 19 0.5

Transmembrane Domains

Domain # Start End Length
1 15 37 22
2 57 79 22
3 117 139 22
4 234 256 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|230
MSLAYFYSWHTGLSKAQAYGLLLGYCAIYVLPLHSLLAAKLSPSRSRDDPKVIRARVRAVSFSTTACSLITFFIL
RQTIPVSDSRPGSASGLPSLGSQSVLHLMGCWPPGLLETAKASLLTVFLFAGPIFECLFLDGVWKQWLRLAPLQR
LWNDWPTWRNTVVGPVTEEFLFRSAAVPLLLLADADLKSIIFRSPLVFGLAHVHHFYEFRISQPYTPVSAAIARS
AFQFSYTSIFGIYATFIFLRTGSLLAVICVHTTR
Coding >Ophio5|230
ATGTCTTTGGCATATTTCTACTCTTGGCACACCGGCCTGAGCAAGGCACAAGCGTACGGCCTACTGTTGGGCTAT
TGCGCCATCTACGTCTTACCACTACACAGTCTATTGGCTGCCAAGCTCTCACCATCACGATCCAGAGATGACCCC
AAAGTAATTCGGGCTAGAGTGCGTGCAGTGTCTTTCTCAACGACGGCGTGCTCTCTTATTACTTTCTTTATTCTC
CGGCAGACCATCCCGGTCTCCGACTCTCGGCCGGGTTCTGCTTCGGGGCTTCCAAGTCTCGGCTCACAGTCTGTC
TTGCATCTCATGGGATGCTGGCCGCCGGGCCTACTCGAGACCGCCAAAGCCTCACTCCTTACTGTTTTTCTCTTC
GCTGGCCCTATATTCGAGTGCTTATTTTTGGATGGGGTATGGAAGCAGTGGCTGCGGCTCGCACCCCTGCAGCGT
CTTTGGAACGACTGGCCAACTTGGCGAAATACTGTTGTTGGCCCGGTCACTGAGGAGTTTCTCTTCCGCTCCGCT
GCTGTACCTTTACTACTACTCGCAGATGCTGACTTGAAAAGCATCATTTTTCGGTCCCCCTTGGTATTTGGCCTT
GCCCATGTCCATCATTTCTACGAGTTTCGCATCAGTCAACCCTACACACCTGTTTCTGCCGCCATAGCCCGCTCT
GCCTTCCAGTTTTCTTACACAAGCATTTTTGGCATCTACGCTACCTTCATTTTTTTGCGTACAGGGTCTCTCCTG
GCTGTCATCTGCGTACATACGACCCGA
Transcript >Ophio5|230
ATGTCTTTGGCATATTTCTACTCTTGGCACACCGGCCTGAGCAAGGCACAAGCGTACGGCCTACTGTTGGGCTAT
TGCGCCATCTACGTCTTACCACTACACAGTCTATTGGCTGCCAAGCTCTCACCATCACGATCCAGAGATGACCCC
AAAGTAATTCGGGCTAGAGTGCGTGCAGTGTCTTTCTCAACGACGGCGTGCTCTCTTATTACTTTCTTTATTCTC
CGGCAGACCATCCCGGTCTCCGACTCTCGGCCGGGTTCTGCTTCGGGGCTTCCAAGTCTCGGCTCACAGTCTGTC
TTGCATCTCATGGGATGCTGGCCGCCGGGCCTACTCGAGACCGCCAAAGCCTCACTCCTTACTGTTTTTCTCTTC
GCTGGCCCTATATTCGAGTGCTTATTTTTGGATGGGGTATGGAAGCAGTGGCTGCGGCTCGCACCCCTGCAGCGT
CTTTGGAACGACTGGCCAACTTGGCGAAATACTGTTGTTGGCCCGGTCACTGAGGAGTTTCTCTTCCGCTCCGCT
GCTGTACCTTTACTACTACTCGCAGATGCTGACTTGAAAAGCATCATTTTTCGGTCCCCCTTGGTATTTGGCCTT
GCCCATGTCCATCATTTCTACGAGTTTCGCATCAGTCAACCCTACACACCTGTTTCTGCCGCCATAGCCCGCTCT
GCCTTCCAGTTTTCTTACACAAGCATTTTTGGCATCTACGCTACCTTCATTTTTTTGCGTACAGGGTCTCTCCTG
GCTGTCATCTGCGTACATACGACCCGATAA
Gene >Ophio5|230
ATGTCTTTGGCATATTTCTACTCTTGGCACACCGGCCTGAGCAAGGCACAAGCGTACGGCCTACTGGTAAGTCCG
TTTCATCATCGAAGCCTAGTAACGGCCAGGGGTAGCCAGAGTAAAGCAAGGCAAGGTGAATGGCCACGATGGGTA
GCTCGGACAGCGGTTTGCTTGTCACCTGATGAGCCCGGACGTTTCTTTTGCTCGATTATACGGAGACGAAGTTTA
GGCTTCATACCTCGTGTTGCACTTCCCAATATGGCCAGTCAAGCAGTTCGTGATAGCTAATCTTTTACAAAGTTG
GGCTATTGCGCCATCTACGTCTTACCACTACACAGTCTATTGGCTGCCAAGCTCTCACCATCACGATCCAGAGAT
GACCCCAAAGTAATTCGGGCTAGAGTGCGTGCAGTGTCTTTCTCAACGACGGCGTGCTCTCTTATTACTTTCTTT
ATTCTCCGGCAGACCATCCCGGTCTCCGACTCTCGGCCGGGTTCTGCTTCGGGGCTTCCAAGTCTCGGCTCACAG
TCTGTCTTGCATCTCATGGGATGCTGGCCGCCGGGCCTACTCGAGACCGCCAAAGCCTCACTCCTTACTGTTTTT
CTCTTCGCTGGCCCTATATTCGAGTGCTTATTTTTGGATGGGGTATGGAAGCAGTGGCTGCGGCTCGCACCCCTG
CAGCGTCTTTGGAACGACTGGCCAACTTGGCGAAATACTGTTGTTGTAGGTTCATGTCGTTGCTATCAGATCGTG
CATGTTGCTAATGCTACCTTCTTTTCAACGTGTTGTTACTGATGAGTGCTCCTCTAGGGCCCGGTCACTGAGGAG
TTTCTCTTCCGCTCCGCTGCTGTACCTTTACTACTACTCGCAGATGCTGACTTGAAAAGCATCATTTTTCGGTCC
CCCTTGGTATTTGGCCTTGCCCATGTCCATCATTTCTACGAGTTTCGCATCAGTCAACCCTACACACCTGTTTCT
GCCGCCATAGCCCGCTCTGCCTTCCAGTTTTCTTACACAAGCATTTTTGGCATCTACGCTACCTTCATTTTTTTG
CGTACAGGGTCTCTCCTGGCTGTCATCTGCGTACATACGGTATGCAATTCTCTGGGACTTCCAAGGGTTTGGGGC
TTTGTAGAGCCATACTGGTTGTCTTGTGACAGACCCGATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail