Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|2299
Gene name
Locationscaffold_196:26792..30362
Strand+
Gene length (bp)3570
Transcript length (bp)3570
Coding sequence length (bp)3567
Protein length (aa) 1189

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02714 RSN1_7TM Calcium-dependent channel, 7TM region, putative phosphate 2.2E-71 700 982
PF13967 RSN1_TM Late exocytosis, associated with Golgi transport 4.3E-43 40 203
PF14703 PHM7_cyt Cytosolic domain of 10TM putative phosphate transporter 1.8E-07 227 300
PF14703 PHM7_cyt Cytosolic domain of 10TM putative phosphate transporter 7.0E-16 582 689
PF12621 PHM7_ext Extracellular tail, of 10TM putative phosphate transporter 8.4E-17 1101 1180

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q03516|RSN1_YEAST Uncharacterized protein RSN1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RSN1 PE=1 SV=1 584 1028 2.0E-72
sp|Q09766|YA7D_SCHPO Uncharacterized membrane protein C24H6.13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC24H6.13 PE=1 SV=1 582 1184 4.0E-68
sp|Q12252|PHM7_YEAST Phosphate metabolism protein 7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PHM7 PE=1 SV=1 586 1029 2.0E-52
sp|Q07798|SPO75_YEAST Sporulation-specific protein 75 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SPO75 PE=1 SV=1 645 1010 1.0E-30
sp|Q03516|RSN1_YEAST Uncharacterized protein RSN1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RSN1 PE=1 SV=1 42 286 1.0E-23
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q03516|RSN1_YEAST Uncharacterized protein RSN1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RSN1 PE=1 SV=1 584 1028 2.0E-72
sp|Q09766|YA7D_SCHPO Uncharacterized membrane protein C24H6.13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC24H6.13 PE=1 SV=1 582 1184 4.0E-68
sp|Q12252|PHM7_YEAST Phosphate metabolism protein 7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PHM7 PE=1 SV=1 586 1029 2.0E-52
sp|Q07798|SPO75_YEAST Sporulation-specific protein 75 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SPO75 PE=1 SV=1 645 1010 1.0E-30
sp|Q03516|RSN1_YEAST Uncharacterized protein RSN1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RSN1 PE=1 SV=1 42 286 1.0E-23
sp|Q9LVE4|CSCL4_ARATH CSC1-like protein At3g21620 OS=Arabidopsis thaliana GN=At3g21620 PE=2 SV=1 583 981 4.0E-21
sp|Q9FVQ5|CSCL1_ARATH CSC1-like protein At1g32090 OS=Arabidopsis thaliana GN=At1g32090 PE=1 SV=1 586 981 1.0E-20
sp|Q09809|CSC1_SCHPO Calcium permeable stress-gated cation channel 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC2G11.09 PE=3 SV=2 611 981 1.0E-20
sp|B5TYT3|CSCL7_ARATH CSC1-like protein At1g11960 OS=Arabidopsis thaliana GN=At1g11960 PE=2 SV=1 612 981 2.0E-19
sp|Q8VZM5|CSCL3_ARATH CSC1-like protein At4g15430 OS=Arabidopsis thaliana GN=At4g15430 PE=2 SV=1 612 981 2.0E-18
sp|Q5XEZ5|CSC1_ARATH Calcium permeable stress-gated cation channel 1 OS=Arabidopsis thaliana GN=CSC1 PE=2 SV=1 612 981 2.0E-17
sp|Q9SY14|CSCL2_ARATH CSC1-like protein At4g02900 OS=Arabidopsis thaliana GN=At4g02900 PE=3 SV=1 644 981 3.0E-17
sp|F4HYR3|CSCL6_ARATH CSC1-like protein At1g62320 OS=Arabidopsis thaliana GN=At1g62320 PE=3 SV=2 561 981 4.0E-17
sp|Q09766|YA7D_SCHPO Uncharacterized membrane protein C24H6.13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC24H6.13 PE=1 SV=1 50 298 7.0E-17
sp|Q9XEA1|CSCL5_ARATH Protein OSCA1 OS=Arabidopsis thaliana GN=OSCA1 PE=1 SV=1 572 982 1.0E-16
sp|Q9C8G5|CSCLD_ARATH CSC1-like protein ERD4 OS=Arabidopsis thaliana GN=ERD4 PE=2 SV=1 589 980 3.0E-16
sp|F4JCY2|CSCL8_ARATH CSC1-like protein At3g54510 OS=Arabidopsis thaliana GN=At3g54510 PE=2 SV=1 648 1039 6.0E-16
sp|A9LIW2|CSC1L_BRAJU CSC1-like protein ERD4 OS=Brassica juncea GN=ERD4 PE=3 SV=2 589 980 7.0E-16
sp|F4I248|CSCLB_ARATH CSC1-like protein At1g69450 OS=Arabidopsis thaliana GN=At1g69450 PE=2 SV=1 645 988 1.0E-15
sp|Q8GUH7|CSCLC_ARATH CSC1-like protein HYP1 OS=Arabidopsis thaliana GN=HYP1 PE=2 SV=1 604 1047 2.0E-12
sp|Q06538|CSC1_YEAST Calcium permeable stress-gated cation channel 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CSC1 PE=1 SV=1 576 980 2.0E-11
sp|Q12252|PHM7_YEAST Phosphate metabolism protein 7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PHM7 PE=1 SV=1 37 316 3.0E-11
sp|Q94A87|CSCL9_ARATH CSC1-like protein At1g10090 OS=Arabidopsis thaliana GN=At1g10090 PE=1 SV=1 682 982 4.0E-11
sp|F4IBD7|CSCLA_ARATH CSC1-like protein RXW8 OS=Arabidopsis thaliana GN=RXW8 PE=2 SV=1 682 982 2.0E-10
sp|Q9LVE4|CSCL4_ARATH CSC1-like protein At3g21620 OS=Arabidopsis thaliana GN=At3g21620 PE=2 SV=1 104 235 3.0E-09
sp|Q9XEA1|CSCL5_ARATH Protein OSCA1 OS=Arabidopsis thaliana GN=OSCA1 PE=1 SV=1 102 248 8.0E-09
sp|F4HYR3|CSCL6_ARATH CSC1-like protein At1g62320 OS=Arabidopsis thaliana GN=At1g62320 PE=3 SV=2 68 235 9.0E-09
sp|Q9SY14|CSCL2_ARATH CSC1-like protein At4g02900 OS=Arabidopsis thaliana GN=At4g02900 PE=3 SV=1 104 235 6.0E-08
sp|Q5XEZ5|CSC1_ARATH Calcium permeable stress-gated cation channel 1 OS=Arabidopsis thaliana GN=CSC1 PE=2 SV=1 49 235 9.0E-08
sp|Q07798|SPO75_YEAST Sporulation-specific protein 75 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SPO75 PE=1 SV=1 22 221 1.0E-07
sp|B5TYT3|CSCL7_ARATH CSC1-like protein At1g11960 OS=Arabidopsis thaliana GN=At1g11960 PE=2 SV=1 49 235 5.0E-07
sp|O43022|YGV8_SCHPO Uncharacterized protein C354.08c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC354.08c PE=3 SV=1 612 1013 9.0E-07
sp|Q8VZM5|CSCL3_ARATH CSC1-like protein At4g15430 OS=Arabidopsis thaliana GN=At4g15430 PE=2 SV=1 104 235 4.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016020 membrane Yes
GO:0110165 cellular anatomical entity No
GO:0005575 cellular_component No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 35 0.5

Transmembrane Domains

Domain # Start End Length
1 40 62 22
2 123 145 22
3 182 204 22
4 703 725 22
5 757 779 22
6 792 814 22
7 858 880 22
8 915 937 22
9 963 985 22
10 998 1020 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|2299
MADVTNSFQPPSSVHGLGLYRRDDDPTSKAQSSRNISITAFVTALNTAIIVCVVQILIFVLLRNRLARIFKPRTY
LVPERERTDPPPANAFAMLRQLVMYDDRKIINKCGLDAYFFLRYLKTLLVIFIPICSIVLPILIPINFIGGKGHQ
VDAKPGRANNSTPSGLDTLAWGNVSPQHTSRYAAHLILAICVVIWVCTVFFFEMRVYIKVRQDYLTSAEHRLRAS
ATTVLVNAIPDKWLTVDALMGLFDVFPGGVRNVWLNRDLTKLLDKIDQRGRVHSMLESAETDLIKDAKKAQLKQR
DSQEKKKRKQQNIKAPSKQERAARNAQHDAEASRLANSGEGTNAGSQDNTMDSTLLSASLDMSDRVSHELETVPE
EGWKHTGSFATHGVKKSLSKVGRGVRGAATKASNEVSSSLSRSHGFMPTVSASEQKTPLHSSGSTRAYNSAEQEQ
VTHLASKSLDTARTHSRSASAASEMSTTTSHRNSQMTAPANTVRKLASIDDMYVQERTRFWQFWKPPSGAYTSPV
PQGETPRESMEERSSKEMSSWQRIKTSLPFMGEDEEKVEYPLAHAPDLKPDADEGAEWAKYIKTKNRPTHRLPPF
GVNWLPGLPWFNKKVDSIYWCREELARLNLEIEEDQKHPERFPLMRSAFIQFNHQVAAHMACQSVVHHIPRQMAP
RMNEISPQDVMWENMALSWWQAWLRSAIVIILVSAMILLWTPLVAWTAVLSQLDKTLRQVGWLGPFENSPQAMNI
IKGLSGVLPAIFLAVVLLLAPMLLRLLATFKGAKTGAQRSEFVQVFFFIFLFVQVFLVVSIASFFSKSVLGFVKD
LGQRLQSVTEVLDILALNLPASANYFFSYMILQGMSTSAGTLLQVASLFIWFVVAPMLDNTPRNKWSRNTTLKQV
EWDSLFPVYTNFACIGLVYCVTAPLISIFVVITFSLLWVAQRYTMLYVCRFETDTGGVLYPRAINQTFTGLYFME
LCMAGLFLIVQNEKEKRTCTAHGVVMIVVFLLTALYQILLNVSFSPLLRYLPITFEDEAVLRDEAFQRAQDLRFS
TARDEARQDVSVDSKGRESEVRLSFGDYRRRQRQRDLEDQRAIGDALYGGVPDDIEDLTPEQRDALTRHAFHHYA
LRARRPTVWIPRDDLGVSDDEIQRTREYSENIWISNEGTALDSKVRVVYGKNPPDFSEADIINL
Coding >Ophio5|2299
ATGGCCGACGTCACGAATTCCTTTCAACCTCCGAGCTCGGTCCATGGCCTCGGCTTGTACCGTCGCGACGATGAT
CCGACCAGCAAGGCCCAGAGCTCTCGCAACATCAGCATCACGGCCTTCGTTACGGCCCTCAACACCGCCATCATC
GTTTGCGTCGTCCAGATCCTCATCTTCGTCCTGCTGCGCAACAGGCTGGCTCGCATCTTCAAACCAAGAACCTAT
CTGGTTCCCGAGCGCGAACGCACCGATCCGCCGCCCGCCAATGCCTTTGCTATGCTCCGCCAGCTGGTCATGTAC
GACGACCGCAAAATCATCAACAAGTGCGGCCTGGATGCCTACTTCTTCCTCAGATACCTCAAGACCCTACTCGTC
ATCTTCATCCCTATATGCTCCATCGTTTTGCCCATCCTTATCCCTATTAATTTTATCGGTGGTAAAGGCCATCAG
GTGGATGCGAAACCGGGTCGCGCAAACAACAGCACGCCCTCTGGACTCGATACGCTGGCATGGGGAAATGTTTCT
CCCCAACACACGAGCCGGTACGCCGCCCACCTGATTCTGGCAATTTGTGTCGTCATCTGGGTTTGCACCGTGTTT
TTCTTCGAGATGCGAGTCTATATCAAGGTTCGGCAGGACTATCTCACGAGCGCCGAACATCGACTGCGCGCCTCG
GCTACTACCGTCCTTGTCAACGCCATCCCCGACAAGTGGCTGACTGTCGACGCTCTCATGGGACTTTTCGACGTA
TTCCCGGGCGGCGTGCGAAATGTTTGGCTCAACAGAGACCTGACCAAGTTGCTCGACAAGATTGATCAGAGAGGC
CGAGTTCATTCCATGCTGGAGTCTGCCGAGACCGACCTGATCAAGGACGCCAAGAAGGCGCAGCTCAAGCAAAGA
GATTCTCAAGAAAAAAAGAAGCGGAAACAACAGAATATCAAGGCTCCATCCAAGCAGGAGCGGGCCGCCCGCAAC
GCTCAACATGACGCCGAGGCGAGCCGCTTGGCAAACAGCGGCGAGGGCACCAATGCCGGCAGTCAGGATAATACC
ATGGACTCCACTCTCCTCTCTGCCAGCCTGGATATGTCTGACAGGGTCAGCCATGAGCTCGAGACTGTGCCCGAA
GAGGGTTGGAAGCATACCGGCAGCTTCGCCACTCACGGCGTCAAAAAGTCTCTATCCAAAGTCGGCAGGGGGGTA
AGAGGAGCTGCCACCAAGGCCAGCAATGAAGTCTCTAGCTCGTTGAGCAGAAGCCACGGCTTCATGCCCACGGTT
TCCGCGAGCGAGCAGAAGACTCCTCTTCACTCTTCAGGCTCCACGAGGGCCTACAACTCTGCGGAGCAGGAACAA
GTAACGCATCTGGCTTCGAAATCGCTCGACACGGCACGAACTCATTCTCGCAGCGCCTCGGCTGCCTCGGAAATG
TCGACGACGACGTCGCATCGAAACAGTCAGATGACGGCTCCGGCAAATACAGTCCGAAAGCTGGCTAGCATCGAC
GACATGTACGTCCAGGAGCGCACGAGATTCTGGCAGTTTTGGAAGCCTCCATCAGGCGCCTACACATCCCCGGTA
CCCCAAGGGGAGACACCGAGGGAGTCGATGGAGGAGCGGTCCAGCAAGGAGATGTCCTCCTGGCAGAGGATCAAG
ACGTCACTACCGTTCATGGGCGAGGACGAGGAAAAGGTGGAATACCCTCTCGCCCACGCTCCGGACCTCAAGCCA
GACGCCGACGAGGGCGCTGAGTGGGCCAAATACATCAAGACTAAGAACAGGCCCACGCATCGTCTACCCCCGTTT
GGGGTGAATTGGCTGCCCGGCCTCCCCTGGTTCAACAAAAAGGTCGACAGCATCTACTGGTGCCGAGAGGAGCTC
GCCCGGCTCAACCTGGAGATTGAAGAGGACCAAAAACACCCGGAGCGATTCCCCCTGATGAGGTCGGCTTTCATC
CAGTTCAACCACCAGGTGGCGGCACACATGGCCTGCCAAAGCGTCGTGCACCATATACCGAGGCAGATGGCACCG
CGCATGAACGAAATCTCGCCCCAAGATGTCATGTGGGAAAACATGGCCCTCAGCTGGTGGCAAGCGTGGCTGCGG
TCTGCCATTGTCATTATCCTTGTGTCGGCTATGATTTTGCTCTGGACCCCGTTGGTGGCGTGGACGGCGGTGCTG
AGCCAGCTCGACAAAACGCTGCGTCAGGTGGGATGGCTGGGCCCGTTCGAGAACAGCCCGCAGGCGATGAATATC
ATCAAGGGGCTCTCGGGCGTGCTTCCTGCCATCTTTCTCGCCGTGGTGCTACTTTTGGCGCCCATGCTCCTCAGG
CTGCTGGCAACCTTCAAGGGCGCCAAGACGGGGGCGCAGAGGTCGGAATTCGTCCAAGTCTTCTTCTTCATCTTT
CTCTTCGTTCAAGTCTTCCTCGTCGTGTCCATCGCTTCCTTCTTCAGCAAGTCCGTCTTGGGCTTCGTCAAGGAC
CTGGGGCAGCGACTGCAGTCCGTGACCGAAGTGCTGGACATACTTGCGCTGAACCTACCGGCATCGGCCAACTAC
TTTTTCTCTTACATGATCCTCCAGGGAATGTCGACGAGTGCGGGCACTCTGCTGCAGGTGGCTTCGCTCTTCATC
TGGTTCGTCGTGGCGCCCATGTTGGACAACACGCCGCGGAACAAGTGGTCGCGGAACACGACGCTCAAGCAGGTT
GAGTGGGATAGCCTGTTCCCCGTGTACACCAATTTCGCCTGTATCGGTCTCGTCTATTGCGTTACCGCGCCGCTG
ATATCCATCTTCGTCGTCATCACCTTCAGTCTCCTCTGGGTGGCGCAGAGATACACGATGCTCTACGTCTGCAGG
TTCGAGACGGATACCGGCGGCGTTCTCTACCCCCGGGCCATCAACCAGACTTTTACGGGCCTATATTTCATGGAG
CTTTGCATGGCCGGTCTGTTCCTTATAGTGCAGAACGAGAAGGAAAAGCGAACTTGCACGGCGCACGGTGTCGTC
ATGATTGTCGTCTTCCTCCTGACCGCCCTGTACCAAATCCTTCTCAACGTCTCCTTCTCACCTTTGCTCCGATAC
CTGCCGATAACGTTCGAGGACGAGGCCGTCCTGCGCGACGAGGCCTTCCAGCGGGCACAGGACCTTCGATTCAGC
ACGGCGCGCGACGAGGCACGGCAGGACGTCTCGGTGGACAGCAAAGGGCGCGAGTCCGAGGTGCGATTGAGCTTT
GGCGATTACCGGCGGCGGCAGCGGCAGCGGGACCTCGAAGACCAGCGCGCCATAGGAGACGCGCTATACGGCGGA
GTGCCCGACGACATTGAGGATCTGACGCCCGAGCAGCGGGACGCGCTGACGCGACACGCCTTTCACCACTACGCC
CTGAGGGCGCGGAGGCCGACGGTCTGGATCCCGCGCGACGACCTGGGCGTCAGCGACGACGAGATCCAGCGAACA
CGCGAGTACAGCGAGAATATCTGGATCAGCAACGAGGGGACGGCGCTGGACAGCAAGGTTCGCGTTGTGTACGGC
AAGAATCCGCCCGACTTTTCGGAAGCAGACATCATCAACCTC
Transcript >Ophio5|2299
ATGGCCGACGTCACGAATTCCTTTCAACCTCCGAGCTCGGTCCATGGCCTCGGCTTGTACCGTCGCGACGATGAT
CCGACCAGCAAGGCCCAGAGCTCTCGCAACATCAGCATCACGGCCTTCGTTACGGCCCTCAACACCGCCATCATC
GTTTGCGTCGTCCAGATCCTCATCTTCGTCCTGCTGCGCAACAGGCTGGCTCGCATCTTCAAACCAAGAACCTAT
CTGGTTCCCGAGCGCGAACGCACCGATCCGCCGCCCGCCAATGCCTTTGCTATGCTCCGCCAGCTGGTCATGTAC
GACGACCGCAAAATCATCAACAAGTGCGGCCTGGATGCCTACTTCTTCCTCAGATACCTCAAGACCCTACTCGTC
ATCTTCATCCCTATATGCTCCATCGTTTTGCCCATCCTTATCCCTATTAATTTTATCGGTGGTAAAGGCCATCAG
GTGGATGCGAAACCGGGTCGCGCAAACAACAGCACGCCCTCTGGACTCGATACGCTGGCATGGGGAAATGTTTCT
CCCCAACACACGAGCCGGTACGCCGCCCACCTGATTCTGGCAATTTGTGTCGTCATCTGGGTTTGCACCGTGTTT
TTCTTCGAGATGCGAGTCTATATCAAGGTTCGGCAGGACTATCTCACGAGCGCCGAACATCGACTGCGCGCCTCG
GCTACTACCGTCCTTGTCAACGCCATCCCCGACAAGTGGCTGACTGTCGACGCTCTCATGGGACTTTTCGACGTA
TTCCCGGGCGGCGTGCGAAATGTTTGGCTCAACAGAGACCTGACCAAGTTGCTCGACAAGATTGATCAGAGAGGC
CGAGTTCATTCCATGCTGGAGTCTGCCGAGACCGACCTGATCAAGGACGCCAAGAAGGCGCAGCTCAAGCAAAGA
GATTCTCAAGAAAAAAAGAAGCGGAAACAACAGAATATCAAGGCTCCATCCAAGCAGGAGCGGGCCGCCCGCAAC
GCTCAACATGACGCCGAGGCGAGCCGCTTGGCAAACAGCGGCGAGGGCACCAATGCCGGCAGTCAGGATAATACC
ATGGACTCCACTCTCCTCTCTGCCAGCCTGGATATGTCTGACAGGGTCAGCCATGAGCTCGAGACTGTGCCCGAA
GAGGGTTGGAAGCATACCGGCAGCTTCGCCACTCACGGCGTCAAAAAGTCTCTATCCAAAGTCGGCAGGGGGGTA
AGAGGAGCTGCCACCAAGGCCAGCAATGAAGTCTCTAGCTCGTTGAGCAGAAGCCACGGCTTCATGCCCACGGTT
TCCGCGAGCGAGCAGAAGACTCCTCTTCACTCTTCAGGCTCCACGAGGGCCTACAACTCTGCGGAGCAGGAACAA
GTAACGCATCTGGCTTCGAAATCGCTCGACACGGCACGAACTCATTCTCGCAGCGCCTCGGCTGCCTCGGAAATG
TCGACGACGACGTCGCATCGAAACAGTCAGATGACGGCTCCGGCAAATACAGTCCGAAAGCTGGCTAGCATCGAC
GACATGTACGTCCAGGAGCGCACGAGATTCTGGCAGTTTTGGAAGCCTCCATCAGGCGCCTACACATCCCCGGTA
CCCCAAGGGGAGACACCGAGGGAGTCGATGGAGGAGCGGTCCAGCAAGGAGATGTCCTCCTGGCAGAGGATCAAG
ACGTCACTACCGTTCATGGGCGAGGACGAGGAAAAGGTGGAATACCCTCTCGCCCACGCTCCGGACCTCAAGCCA
GACGCCGACGAGGGCGCTGAGTGGGCCAAATACATCAAGACTAAGAACAGGCCCACGCATCGTCTACCCCCGTTT
GGGGTGAATTGGCTGCCCGGCCTCCCCTGGTTCAACAAAAAGGTCGACAGCATCTACTGGTGCCGAGAGGAGCTC
GCCCGGCTCAACCTGGAGATTGAAGAGGACCAAAAACACCCGGAGCGATTCCCCCTGATGAGGTCGGCTTTCATC
CAGTTCAACCACCAGGTGGCGGCACACATGGCCTGCCAAAGCGTCGTGCACCATATACCGAGGCAGATGGCACCG
CGCATGAACGAAATCTCGCCCCAAGATGTCATGTGGGAAAACATGGCCCTCAGCTGGTGGCAAGCGTGGCTGCGG
TCTGCCATTGTCATTATCCTTGTGTCGGCTATGATTTTGCTCTGGACCCCGTTGGTGGCGTGGACGGCGGTGCTG
AGCCAGCTCGACAAAACGCTGCGTCAGGTGGGATGGCTGGGCCCGTTCGAGAACAGCCCGCAGGCGATGAATATC
ATCAAGGGGCTCTCGGGCGTGCTTCCTGCCATCTTTCTCGCCGTGGTGCTACTTTTGGCGCCCATGCTCCTCAGG
CTGCTGGCAACCTTCAAGGGCGCCAAGACGGGGGCGCAGAGGTCGGAATTCGTCCAAGTCTTCTTCTTCATCTTT
CTCTTCGTTCAAGTCTTCCTCGTCGTGTCCATCGCTTCCTTCTTCAGCAAGTCCGTCTTGGGCTTCGTCAAGGAC
CTGGGGCAGCGACTGCAGTCCGTGACCGAAGTGCTGGACATACTTGCGCTGAACCTACCGGCATCGGCCAACTAC
TTTTTCTCTTACATGATCCTCCAGGGAATGTCGACGAGTGCGGGCACTCTGCTGCAGGTGGCTTCGCTCTTCATC
TGGTTCGTCGTGGCGCCCATGTTGGACAACACGCCGCGGAACAAGTGGTCGCGGAACACGACGCTCAAGCAGGTT
GAGTGGGATAGCCTGTTCCCCGTGTACACCAATTTCGCCTGTATCGGTCTCGTCTATTGCGTTACCGCGCCGCTG
ATATCCATCTTCGTCGTCATCACCTTCAGTCTCCTCTGGGTGGCGCAGAGATACACGATGCTCTACGTCTGCAGG
TTCGAGACGGATACCGGCGGCGTTCTCTACCCCCGGGCCATCAACCAGACTTTTACGGGCCTATATTTCATGGAG
CTTTGCATGGCCGGTCTGTTCCTTATAGTGCAGAACGAGAAGGAAAAGCGAACTTGCACGGCGCACGGTGTCGTC
ATGATTGTCGTCTTCCTCCTGACCGCCCTGTACCAAATCCTTCTCAACGTCTCCTTCTCACCTTTGCTCCGATAC
CTGCCGATAACGTTCGAGGACGAGGCCGTCCTGCGCGACGAGGCCTTCCAGCGGGCACAGGACCTTCGATTCAGC
ACGGCGCGCGACGAGGCACGGCAGGACGTCTCGGTGGACAGCAAAGGGCGCGAGTCCGAGGTGCGATTGAGCTTT
GGCGATTACCGGCGGCGGCAGCGGCAGCGGGACCTCGAAGACCAGCGCGCCATAGGAGACGCGCTATACGGCGGA
GTGCCCGACGACATTGAGGATCTGACGCCCGAGCAGCGGGACGCGCTGACGCGACACGCCTTTCACCACTACGCC
CTGAGGGCGCGGAGGCCGACGGTCTGGATCCCGCGCGACGACCTGGGCGTCAGCGACGACGAGATCCAGCGAACA
CGCGAGTACAGCGAGAATATCTGGATCAGCAACGAGGGGACGGCGCTGGACAGCAAGGTTCGCGTTGTGTACGGC
AAGAATCCGCCCGACTTTTCGGAAGCAGACATCATCAACCTCTGA
Gene >Ophio5|2299
ATGGCCGACGTCACGAATTCCTTTCAACCTCCGAGCTCGGTCCATGGCCTCGGCTTGTACCGTCGCGACGATGAT
CCGACCAGCAAGGCCCAGAGCTCTCGCAACATCAGCATCACGGCCTTCGTTACGGCCCTCAACACCGCCATCATC
GTTTGCGTCGTCCAGATCCTCATCTTCGTCCTGCTGCGCAACAGGCTGGCTCGCATCTTCAAACCAAGAACCTAT
CTGGTTCCCGAGCGCGAACGCACCGATCCGCCGCCCGCCAATGCCTTTGCTATGCTCCGCCAGCTGGTCATGTAC
GACGACCGCAAAATCATCAACAAGTGCGGCCTGGATGCCTACTTCTTCCTCAGATACCTCAAGACCCTACTCGTC
ATCTTCATCCCTATATGCTCCATCGTTTTGCCCATCCTTATCCCTATTAATTTTATCGGTGGTAAAGGCCATCAG
GTGGATGCGAAACCGGGTCGCGCAAACAACAGCACGCCCTCTGGACTCGATACGCTGGCATGGGGAAATGTTTCT
CCCCAACACACGAGCCGGTACGCCGCCCACCTGATTCTGGCAATTTGTGTCGTCATCTGGGTTTGCACCGTGTTT
TTCTTCGAGATGCGAGTCTATATCAAGGTTCGGCAGGACTATCTCACGAGCGCCGAACATCGACTGCGCGCCTCG
GCTACTACCGTCCTTGTCAACGCCATCCCCGACAAGTGGCTGACTGTCGACGCTCTCATGGGACTTTTCGACGTA
TTCCCGGGCGGCGTGCGAAATGTTTGGCTCAACAGAGACCTGACCAAGTTGCTCGACAAGATTGATCAGAGAGGC
CGAGTTCATTCCATGCTGGAGTCTGCCGAGACCGACCTGATCAAGGACGCCAAGAAGGCGCAGCTCAAGCAAAGA
GATTCTCAAGAAAAAAAGAAGCGGAAACAACAGAATATCAAGGCTCCATCCAAGCAGGAGCGGGCCGCCCGCAAC
GCTCAACATGACGCCGAGGCGAGCCGCTTGGCAAACAGCGGCGAGGGCACCAATGCCGGCAGTCAGGATAATACC
ATGGACTCCACTCTCCTCTCTGCCAGCCTGGATATGTCTGACAGGGTCAGCCATGAGCTCGAGACTGTGCCCGAA
GAGGGTTGGAAGCATACCGGCAGCTTCGCCACTCACGGCGTCAAAAAGTCTCTATCCAAAGTCGGCAGGGGGGTA
AGAGGAGCTGCCACCAAGGCCAGCAATGAAGTCTCTAGCTCGTTGAGCAGAAGCCACGGCTTCATGCCCACGGTT
TCCGCGAGCGAGCAGAAGACTCCTCTTCACTCTTCAGGCTCCACGAGGGCCTACAACTCTGCGGAGCAGGAACAA
GTAACGCATCTGGCTTCGAAATCGCTCGACACGGCACGAACTCATTCTCGCAGCGCCTCGGCTGCCTCGGAAATG
TCGACGACGACGTCGCATCGAAACAGTCAGATGACGGCTCCGGCAAATACAGTCCGAAAGCTGGCTAGCATCGAC
GACATGTACGTCCAGGAGCGCACGAGATTCTGGCAGTTTTGGAAGCCTCCATCAGGCGCCTACACATCCCCGGTA
CCCCAAGGGGAGACACCGAGGGAGTCGATGGAGGAGCGGTCCAGCAAGGAGATGTCCTCCTGGCAGAGGATCAAG
ACGTCACTACCGTTCATGGGCGAGGACGAGGAAAAGGTGGAATACCCTCTCGCCCACGCTCCGGACCTCAAGCCA
GACGCCGACGAGGGCGCTGAGTGGGCCAAATACATCAAGACTAAGAACAGGCCCACGCATCGTCTACCCCCGTTT
GGGGTGAATTGGCTGCCCGGCCTCCCCTGGTTCAACAAAAAGGTCGACAGCATCTACTGGTGCCGAGAGGAGCTC
GCCCGGCTCAACCTGGAGATTGAAGAGGACCAAAAACACCCGGAGCGATTCCCCCTGATGAGGTCGGCTTTCATC
CAGTTCAACCACCAGGTGGCGGCACACATGGCCTGCCAAAGCGTCGTGCACCATATACCGAGGCAGATGGCACCG
CGCATGAACGAAATCTCGCCCCAAGATGTCATGTGGGAAAACATGGCCCTCAGCTGGTGGCAAGCGTGGCTGCGG
TCTGCCATTGTCATTATCCTTGTGTCGGCTATGATTTTGCTCTGGACCCCGTTGGTGGCGTGGACGGCGGTGCTG
AGCCAGCTCGACAAAACGCTGCGTCAGGTGGGATGGCTGGGCCCGTTCGAGAACAGCCCGCAGGCGATGAATATC
ATCAAGGGGCTCTCGGGCGTGCTTCCTGCCATCTTTCTCGCCGTGGTGCTACTTTTGGCGCCCATGCTCCTCAGG
CTGCTGGCAACCTTCAAGGGCGCCAAGACGGGGGCGCAGAGGTCGGAATTCGTCCAAGTCTTCTTCTTCATCTTT
CTCTTCGTTCAAGTCTTCCTCGTCGTGTCCATCGCTTCCTTCTTCAGCAAGTCCGTCTTGGGCTTCGTCAAGGAC
CTGGGGCAGCGACTGCAGTCCGTGACCGAAGTGCTGGACATACTTGCGCTGAACCTACCGGCATCGGCCAACTAC
TTTTTCTCTTACATGATCCTCCAGGGAATGTCGACGAGTGCGGGCACTCTGCTGCAGGTGGCTTCGCTCTTCATC
TGGTTCGTCGTGGCGCCCATGTTGGACAACACGCCGCGGAACAAGTGGTCGCGGAACACGACGCTCAAGCAGGTT
GAGTGGGATAGCCTGTTCCCCGTGTACACCAATTTCGCCTGTATCGGTCTCGTCTATTGCGTTACCGCGCCGCTG
ATATCCATCTTCGTCGTCATCACCTTCAGTCTCCTCTGGGTGGCGCAGAGATACACGATGCTCTACGTCTGCAGG
TTCGAGACGGATACCGGCGGCGTTCTCTACCCCCGGGCCATCAACCAGACTTTTACGGGCCTATATTTCATGGAG
CTTTGCATGGCCGGTCTGTTCCTTATAGTGCAGAACGAGAAGGAAAAGCGAACTTGCACGGCGCACGGTGTCGTC
ATGATTGTCGTCTTCCTCCTGACCGCCCTGTACCAAATCCTTCTCAACGTCTCCTTCTCACCTTTGCTCCGATAC
CTGCCGATAACGTTCGAGGACGAGGCCGTCCTGCGCGACGAGGCCTTCCAGCGGGCACAGGACCTTCGATTCAGC
ACGGCGCGCGACGAGGCACGGCAGGACGTCTCGGTGGACAGCAAAGGGCGCGAGTCCGAGGTGCGATTGAGCTTT
GGCGATTACCGGCGGCGGCAGCGGCAGCGGGACCTCGAAGACCAGCGCGCCATAGGAGACGCGCTATACGGCGGA
GTGCCCGACGACATTGAGGATCTGACGCCCGAGCAGCGGGACGCGCTGACGCGACACGCCTTTCACCACTACGCC
CTGAGGGCGCGGAGGCCGACGGTCTGGATCCCGCGCGACGACCTGGGCGTCAGCGACGACGAGATCCAGCGAACA
CGCGAGTACAGCGAGAATATCTGGATCAGCAACGAGGGGACGGCGCTGGACAGCAAGGTTCGCGTTGTGTACGGC
AAGAATCCGCCCGACTTTTCGGAAGCAGACATCATCAACCTCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail