Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|2292
Gene name
Locationscaffold_196:11175..12695
Strand-
Gene length (bp)1520
Transcript length (bp)1383
Coding sequence length (bp)1380
Protein length (aa) 460

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00781 DAGK_cat Diacylglycerol kinase catalytic domain 4.8E-06 104 219

Swissprot hits

(None)

GO

GO Term Description Terminal node
GO:0016301 kinase activity Yes
GO:0016772 transferase activity, transferring phosphorus-containing groups No
GO:0003824 catalytic activity No
GO:0016740 transferase activity No
GO:0003674 molecular_function No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Nucleus Nuclear localization signal|Nuclear export signal 0.694 0.6585 0.1502 0.0796 0.2615 0.0052 0.2974 0.3077 0.4393 0.0546

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup1399
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5823
Ophiocordyceps australis map64 (Brazil) OphauB2|1273
Ophiocordyceps camponoti-floridani Ophcf2|04060
Ophiocordyceps camponoti-rufipedis Ophun1|2149
Ophiocordyceps kimflemingae Ophio5|2292 (this protein)
Ophiocordyceps subramaniannii Hirsu2|10883

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|2292
MNSSADGITLLRVRNMRFREDDSLVWTQSDGIEDEVTANEVLFSLDLTASEKGFIVCCLRESVVGDSQSQVLLVL
AADRLPPGQHQQPTISQLPRHLDQSQVDIIVSTHSGTRLAPTFWQTVLRPLFHVVCDVLGAHPPTEAILTTDALA
VRNFGCRLRSRRGERTVVLLSGDGGVADLLDGYGVEEEEEDEEADERKPSPIIALLPLGTGNALFHSLHRLSSED
GPSSVGPSPLARGLRTLFLGEPAGLPVFRARFSPGSHLVRASDEDEEKERPISTLYGTIVASYGFHATLIHESDT
AQYRPHGAQRFSLVARTLLDKPHSYQAEISIDGEPLRQREHGYVLVAMVSNLERTFTISPDSRPLDGKLFLVRFG
NLAPERVLQVMQMAYAGGQHVGLAWDGGERVSYREVDEVLVKVGDEDARWRKVRGEAVSDPGGWPGSEAAVILRR
LFFYSCRGGP
Coding >Ophio5|2292
ATGAACTCGTCGGCCGATGGCATCACGTTGCTCCGGGTGCGCAACATGCGCTTTCGAGAAGACGATAGCCTGGTC
TGGACGCAGAGCGACGGCATCGAAGACGAAGTCACGGCAAACGAGGTTCTCTTCTCACTGGACCTGACAGCGTCA
GAAAAGGGCTTCATAGTCTGCTGTCTTCGCGAGAGCGTCGTCGGCGACAGCCAATCCCAGGTCCTACTCGTCCTC
GCAGCCGACAGATTGCCACCAGGCCAGCACCAGCAACCTACCATCAGTCAGCTCCCTCGTCACCTCGACCAAAGC
CAAGTCGACATCATCGTCTCAACACATTCGGGTACGAGACTGGCACCGACCTTTTGGCAGACAGTGTTGCGTCCG
CTATTTCATGTCGTCTGCGACGTTTTGGGCGCTCATCCGCCGACCGAGGCTATCTTGACGACCGACGCGCTCGCA
GTCAGGAACTTTGGCTGCCGGTTGAGGAGCAGACGTGGTGAGCGGACGGTCGTGTTGCTCAGTGGCGACGGGGGT
GTTGCCGATTTACTGGATGGTTATGGTGTTGAGGAGGAGGAGGAGGATGAGGAGGCTGATGAAAGGAAGCCATCG
CCGATTATCGCCCTTTTACCCCTGGGGACTGGCAACGCCCTGTTTCACTCTCTGCATCGGCTCTCATCTGAGGAT
GGCCCCTCCTCCGTCGGACCTTCGCCGCTGGCTCGGGGCTTGCGAACACTTTTTCTGGGAGAGCCGGCTGGTCTA
CCCGTCTTTCGCGCCCGCTTCTCACCAGGCTCGCATCTAGTGAGGGCATCAGACGAAGACGAAGAAAAGGAAAGG
CCCATCTCGACGCTGTACGGCACCATCGTCGCCAGCTACGGCTTCCACGCCACCCTAATCCACGAAAGCGACACG
GCGCAATACCGCCCCCACGGCGCCCAACGCTTCAGCCTAGTCGCCCGGACGCTGCTCGACAAGCCGCACAGCTAC
CAAGCCGAGATCAGCATCGACGGAGAGCCTCTCCGGCAGCGGGAACACGGCTACGTCCTCGTCGCCATGGTATCC
AATCTGGAGCGCACCTTCACCATCTCGCCCGATAGCAGGCCCCTCGATGGGAAGCTCTTCCTCGTCCGGTTTGGG
AACTTGGCCCCTGAGCGCGTCTTGCAGGTCATGCAGATGGCCTATGCTGGTGGCCAGCACGTGGGCTTGGCTTGG
GACGGTGGTGAGAGGGTTTCCTATCGGGAGGTTGACGAGGTGCTCGTCAAGGTCGGGGATGAGGATGCGAGGTGG
CGCAAGGTCCGAGGCGAGGCCGTTTCGGATCCTGGTGGATGGCCTGGCTCTGAGGCCGCCGTGATTTTACGTCGT
CTCTTCTTCTATTCCTGTAGGGGTGGCCCC
Transcript >Ophio5|2292
ATGAACTCGTCGGCCGATGGCATCACGTTGCTCCGGGTGCGCAACATGCGCTTTCGAGAAGACGATAGCCTGGTC
TGGACGCAGAGCGACGGCATCGAAGACGAAGTCACGGCAAACGAGGTTCTCTTCTCACTGGACCTGACAGCGTCA
GAAAAGGGCTTCATAGTCTGCTGTCTTCGCGAGAGCGTCGTCGGCGACAGCCAATCCCAGGTCCTACTCGTCCTC
GCAGCCGACAGATTGCCACCAGGCCAGCACCAGCAACCTACCATCAGTCAGCTCCCTCGTCACCTCGACCAAAGC
CAAGTCGACATCATCGTCTCAACACATTCGGGTACGAGACTGGCACCGACCTTTTGGCAGACAGTGTTGCGTCCG
CTATTTCATGTCGTCTGCGACGTTTTGGGCGCTCATCCGCCGACCGAGGCTATCTTGACGACCGACGCGCTCGCA
GTCAGGAACTTTGGCTGCCGGTTGAGGAGCAGACGTGGTGAGCGGACGGTCGTGTTGCTCAGTGGCGACGGGGGT
GTTGCCGATTTACTGGATGGTTATGGTGTTGAGGAGGAGGAGGAGGATGAGGAGGCTGATGAAAGGAAGCCATCG
CCGATTATCGCCCTTTTACCCCTGGGGACTGGCAACGCCCTGTTTCACTCTCTGCATCGGCTCTCATCTGAGGAT
GGCCCCTCCTCCGTCGGACCTTCGCCGCTGGCTCGGGGCTTGCGAACACTTTTTCTGGGAGAGCCGGCTGGTCTA
CCCGTCTTTCGCGCCCGCTTCTCACCAGGCTCGCATCTAGTGAGGGCATCAGACGAAGACGAAGAAAAGGAAAGG
CCCATCTCGACGCTGTACGGCACCATCGTCGCCAGCTACGGCTTCCACGCCACCCTAATCCACGAAAGCGACACG
GCGCAATACCGCCCCCACGGCGCCCAACGCTTCAGCCTAGTCGCCCGGACGCTGCTCGACAAGCCGCACAGCTAC
CAAGCCGAGATCAGCATCGACGGAGAGCCTCTCCGGCAGCGGGAACACGGCTACGTCCTCGTCGCCATGGTATCC
AATCTGGAGCGCACCTTCACCATCTCGCCCGATAGCAGGCCCCTCGATGGGAAGCTCTTCCTCGTCCGGTTTGGG
AACTTGGCCCCTGAGCGCGTCTTGCAGGTCATGCAGATGGCCTATGCTGGTGGCCAGCACGTGGGCTTGGCTTGG
GACGGTGGTGAGAGGGTTTCCTATCGGGAGGTTGACGAGGTGCTCGTCAAGGTCGGGGATGAGGATGCGAGGTGG
CGCAAGGTCCGAGGCGAGGCCGTTTCGGATCCTGGTGGATGGCCTGGCTCTGAGGCCGCCGTGATTTTACGTCGT
CTCTTCTTCTATTCCTGTAGGGGTGGCCCCTGA
Gene >Ophio5|2292
ATGAACTCGTCGGCCGATGGCATCACGTTGCTCCGGGTGCGCAACATGCGCTTTCGAGAAGACGATAGCCTGGTC
TGGACGCAGAGCGACGGCATCGAAGACGAAGTCACGGCAAACGAGGTTCTCTTCTCACTGGACCTGACAGCGTCA
GAAAAGGGCTTCATAGTCTGCTGTCTTCGCGAGAGCGTCGTCGGCGACAGCCAATCCCAGGTCCTACTCGTCCTC
GCAGCCGACAGATTGCCACCAGGCCAGCACCAGCAACCTACCATCAGTCAGCTCCCTCGTCACCTCGACCAAAGC
CAAGTCGACATCATCGTCTCAACACATTCGGGTACGAGACTGGCACCGACCTTTTGGCAGACAGTGTTGCGTCCG
CTATTTCATGTCGTCTGCGACGTTTTGGGCGCTCATCCGCCGACCGAGGCTATCTTGACGACCGACGCGCTCGCA
GTCAGGAACTTTGGCTGCCGGTTGAGGAGCAGACGTGGTGAGCGGACGGTCGTGTTGCTCAGTGGCGACGGGGGT
GTTGCCGATTTACTGGATGGTTATGGTGTTGAGGAGGAGGAGGAGGATGAGGAGGCTGATGAAAGGAAGCCATCG
CCGATTATCGCCCTTTTACCCCTGGGGACTGGCAACGCCCTGTTTCACTCTCTGCATCGGCTCTCATCTGAGGAT
GGCCCCTCCTCCGTCGGACCTTCGCCGCTGGCTCGGGGCTTGCGAACACTTTTTCTGGGAGAGCCGGCTGGTCTA
CCCGTCTTTCGCGCCCGCTTCTCACCAGGCTCGCATCTAGTGAGGGCATCAGACGAAGACGAAGAAAAGGAAAGG
CCCATCTCGACGCTGTACGGCACCATCGTCGCCAGCTACGGCTTCCACGCCACCCTAATCCACGAAAGCGACACG
GCGCAATACCGCCCCCACGGCGCCCAACGCTTCAGCCTAGTCGCCCGGACGCTGCTCGACAAGCCGCACAGCTAC
CAAGCCGAGATCAGCATCGACGGAGAGCCTCTCCGGCAGCGGGAACACGGCTACGTCCTCGTCGCCATGGTATCC
AATCTGGAGCGCACCTTCACCATCTCGCCCGATAGCAGGCCCCTCGATGGGAAGCTCTTCCTCGTCCGGTTTGGG
AACTTGGCCCCTGAGCGCGTCTTGCAGGTCATGCAGATGGCCTATGCTGGTGGCCAGCACGTGGGCTTGGCTTGG
GACGGTGGTGAGAGGGTTTCCTATCGGGAGGTTGACGAGGTGCTCGTCAAGGTCGGGGATGAGGATGCGAGGTGG
CGCAAGGTTTGTGTGGATGGGACTATTGTTGAGGTGCCCCAAGGGGGTTCGGTGACGATTGCTAGGTCCGAGGCG
AGGCCGTTTCGGATCCTGGTGGATGGCCTGGCTCTGAGGCCGCCGTGATTTTACGTCGTCTCTTCTTCTATTCCT
GTTGGTCTCGCCTGACCGTTATAGCCTCTCTTTTTTTTTTCTTTTATTTCTACCTGGTATGGACTGATCCCTACC
TAGGTAGGGGTGGCCCCTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail