Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|2288
Gene name
Locationscaffold_195:29106..30209
Strand-
Gene length (bp)1103
Transcript length (bp)1026
Coding sequence length (bp)1023
Protein length (aa) 341

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00406 ADK Adenylate kinase 1.1E-41 151 311
PF13207 AAA_17 AAA domain 4.2E-32 152 289

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P15700|KCY_YEAST Uridylate kinase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=URA6 PE=1 SV=1 131 337 5.0E-80
sp|O59845|KCY_LENED UMP-CMP kinase OS=Lentinula edodes GN=uck1 PE=1 SV=1 145 330 3.0E-76
sp|O59771|KCY_SCHPO Uridylate kinase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1795.05c PE=3 SV=1 148 334 7.0E-66
sp|Q28H12|KCY_XENTR UMP-CMP kinase OS=Xenopus tropicalis GN=cmpk1 PE=2 SV=2 145 330 2.0E-62
sp|Q5ZKE7|KCY_CHICK UMP-CMP kinase OS=Gallus gallus GN=CMPK PE=2 SV=1 145 329 7.0E-62
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P15700|KCY_YEAST Uridylate kinase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=URA6 PE=1 SV=1 131 337 5.0E-80
sp|O59845|KCY_LENED UMP-CMP kinase OS=Lentinula edodes GN=uck1 PE=1 SV=1 145 330 3.0E-76
sp|O59771|KCY_SCHPO Uridylate kinase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1795.05c PE=3 SV=1 148 334 7.0E-66
sp|Q28H12|KCY_XENTR UMP-CMP kinase OS=Xenopus tropicalis GN=cmpk1 PE=2 SV=2 145 330 2.0E-62
sp|Q5ZKE7|KCY_CHICK UMP-CMP kinase OS=Gallus gallus GN=CMPK PE=2 SV=1 145 329 7.0E-62
sp|Q7ZWE9|KCY_DANRE UMP-CMP kinase OS=Danio rerio GN=cmpk PE=2 SV=2 145 335 1.0E-61
sp|Q7ZX23|KCY_XENLA UMP-CMP kinase OS=Xenopus laevis GN=cmpk1 PE=2 SV=2 145 330 1.0E-61
sp|Q4KM73|KCY_RAT UMP-CMP kinase OS=Rattus norvegicus GN=Cmpk1 PE=1 SV=2 145 331 2.0E-60
sp|Q9DBP5|KCY_MOUSE UMP-CMP kinase OS=Mus musculus GN=Cmpk1 PE=1 SV=1 145 331 5.0E-60
sp|Q2KIW9|KCY_BOVIN UMP-CMP kinase OS=Bos taurus GN=CMPK1 PE=2 SV=2 145 331 1.0E-59
sp|Q29561|KCY_PIG UMP-CMP kinase OS=Sus scrofa GN=CMPK1 PE=1 SV=1 148 331 2.0E-59
sp|P30085|KCY_HUMAN UMP-CMP kinase OS=Homo sapiens GN=CMPK1 PE=1 SV=3 145 329 6.0E-59
sp|O04905|KCY3_ARATH UMP-CMP kinase 3 OS=Arabidopsis thaliana GN=UMK3 PE=1 SV=1 142 330 2.0E-58
sp|Q7XI40|KCY3_ORYSJ UMP-CMP kinase 3 OS=Oryza sativa subsp. japonica GN=URA6 PE=2 SV=1 145 330 4.0E-57
sp|Q8VY84|KCY1_ARATH Probable UMP-CMP kinase 1 OS=Arabidopsis thaliana GN=UMK1 PE=2 SV=1 145 326 3.0E-55
sp|Q6K7H2|KCY4_ORYSJ UMP-CMP kinase 4 OS=Oryza sativa subsp. japonica GN=Os02g0778400 PE=2 SV=1 137 327 4.0E-55
sp|Q20140|KAD1_CAEEL Adenylate kinase isoenzyme 1 OS=Caenorhabditis elegans GN=F38B2.4 PE=2 SV=1 148 327 1.0E-52
sp|P20425|KCY_DICDI UMP-CMP kinase OS=Dictyostelium discoideum GN=pyrK PE=1 SV=2 145 334 1.0E-51
sp|P39069|KAD1_RAT Adenylate kinase isoenzyme 1 OS=Rattus norvegicus GN=Ak1 PE=1 SV=3 145 328 2.0E-50
sp|Q9R0Y5|KAD1_MOUSE Adenylate kinase isoenzyme 1 OS=Mus musculus GN=Ak1 PE=1 SV=1 145 328 2.0E-49
sp|P25824|KAD_SCHMA Adenylate kinase OS=Schistosoma mansoni PE=2 SV=1 145 335 7.0E-49
sp|Q20230|KCY2_CAEEL UMP-CMP kinase 2 OS=Caenorhabditis elegans GN=F40F8.1 PE=1 SV=1 147 331 2.0E-48
sp|O17622|KCY1_CAEEL UMP-CMP kinase 1 OS=Caenorhabditis elegans GN=C29F7.3 PE=1 SV=1 147 331 2.0E-48
sp|O24464|KCY_PRUAR UMP-CMP kinase OS=Prunus armeniaca PE=2 SV=1 128 330 2.0E-48
sp|P00569|KAD1_RABIT Adenylate kinase isoenzyme 1 OS=Oryctolagus cuniculus GN=AK1 PE=1 SV=1 145 329 4.0E-48
sp|Q7XMI0|KCY2_ORYSJ UMP-CMP kinase 2 OS=Oryza sativa subsp. japonica GN=Os04g0105500 PE=2 SV=3 145 331 6.0E-48
sp|P00570|KAD1_BOVIN Adenylate kinase isoenzyme 1 OS=Bos taurus GN=AK1 PE=1 SV=2 145 328 7.0E-48
sp|P00571|KAD1_PIG Adenylate kinase isoenzyme 1 OS=Sus scrofa GN=AK1 PE=1 SV=1 145 328 8.0E-48
sp|P00568|KAD1_HUMAN Adenylate kinase isoenzyme 1 OS=Homo sapiens GN=AK1 PE=1 SV=3 145 328 9.0E-48
sp|Q5VRN0|KCY1_ORYSJ UMP-CMP kinase 1 OS=Oryza sativa subsp. japonica GN=Os06g0109600 PE=2 SV=1 129 330 3.0E-45
sp|P12115|KAD1_CYPCA Adenylate kinase isoenzyme 1 OS=Cyprinus carpio GN=ak1 PE=1 SV=2 146 335 5.0E-45
sp|P05081|KAD1_CHICK Adenylate kinase isoenzyme 1 OS=Gallus gallus GN=AK1 PE=1 SV=1 148 329 3.0E-44
sp|Q6NMK6|KCY2_ARATH Probable UMP-CMP kinase 2 OS=Arabidopsis thaliana GN=UMK2 PE=2 SV=1 127 326 3.0E-43
sp|Q920P5|KAD5_MOUSE Adenylate kinase isoenzyme 5 OS=Mus musculus GN=Ak5 PE=1 SV=2 137 328 2.0E-40
sp|A4IFD0|KAD5_BOVIN Adenylate kinase isoenzyme 5 OS=Bos taurus GN=Ak5 PE=2 SV=1 116 328 4.0E-39
sp|Q9Y6K8|KAD5_HUMAN Adenylate kinase isoenzyme 5 OS=Homo sapiens GN=AK5 PE=1 SV=2 117 328 1.0E-38
sp|Q920P5|KAD5_MOUSE Adenylate kinase isoenzyme 5 OS=Mus musculus GN=Ak5 PE=1 SV=2 148 337 2.0E-32
sp|A4IFD0|KAD5_BOVIN Adenylate kinase isoenzyme 5 OS=Bos taurus GN=Ak5 PE=2 SV=1 148 337 2.0E-32
sp|Q9Y6K8|KAD5_HUMAN Adenylate kinase isoenzyme 5 OS=Homo sapiens GN=AK5 PE=1 SV=2 148 337 2.0E-32
sp|C0R000|KAD_BRAHW Adenylate kinase OS=Brachyspira hyodysenteriae (strain ATCC 49526 / WA1) GN=adk PE=3 SV=1 148 333 1.0E-30
sp|Q7MW54|KAD_PORGI Adenylate kinase OS=Porphyromonas gingivalis (strain ATCC BAA-308 / W83) GN=adk PE=3 SV=1 149 325 2.0E-30
sp|B2RIY8|KAD_PORG3 Adenylate kinase OS=Porphyromonas gingivalis (strain ATCC 33277 / DSM 20709 / JCM 12257) GN=adk PE=3 SV=1 149 325 3.0E-30
sp|Q89ZJ0|KAD_BACTN Adenylate kinase OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) GN=adk PE=3 SV=1 149 328 3.0E-30
sp|A6L0Z9|KAD_BACV8 Adenylate kinase OS=Bacteroides vulgatus (strain ATCC 8482 / DSM 1447 / NCTC 11154) GN=adk PE=3 SV=1 149 328 1.0E-29
sp|Q64XA6|KAD_BACFR Adenylate kinase OS=Bacteroides fragilis (strain YCH46) GN=adk PE=3 SV=1 149 331 5.0E-29
sp|Q5LGH0|KAD_BACFN Adenylate kinase OS=Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / JCM 11019 / NCTC 9343) GN=adk PE=3 SV=1 149 331 5.0E-29
sp|A6LD69|KAD_PARD8 Adenylate kinase OS=Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / NCTC 11152) GN=adk PE=3 SV=1 149 335 5.0E-29
sp|Q8DML4|KAD_THEEB Adenylate kinase OS=Thermosynechococcus elongatus (strain BP-1) GN=adk PE=3 SV=1 149 335 6.0E-28
sp|Q0BYD5|KAD_HYPNA Adenylate kinase OS=Hyphomonas neptunium (strain ATCC 15444) GN=adk PE=3 SV=1 149 335 1.0E-26
sp|Q5SHQ9|KAD_THET8 Adenylate kinase OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=adk PE=1 SV=1 144 338 5.0E-26
sp|Q72I25|KAD_THET2 Adenylate kinase OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=adk PE=3 SV=1 144 338 5.0E-26
sp|P49973|KAD_CORGL Adenylate kinase OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=adk PE=3 SV=2 149 333 5.0E-26
sp|A4QBP4|KAD_CORGB Adenylate kinase OS=Corynebacterium glutamicum (strain R) GN=adk PE=3 SV=1 149 333 5.0E-26
sp|C5CGI1|KAD_KOSOT Adenylate kinase OS=Kosmotoga olearia (strain TBF 19.5.1) GN=adk PE=3 SV=1 149 334 5.0E-26
sp|C1CXE5|KAD_DEIDV Adenylate kinase OS=Deinococcus deserti (strain VCD115 / DSM 17065 / LMG 22923) GN=adk PE=3 SV=1 148 334 1.0E-25
sp|A5GVX9|KAD_SYNR3 Adenylate kinase OS=Synechococcus sp. (strain RCC307) GN=adk PE=3 SV=1 148 325 3.0E-25
sp|Q8FS39|KAD_COREF Adenylate kinase OS=Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395) GN=adk PE=3 SV=1 149 333 3.0E-25
sp|A5FMV7|KAD_FLAJ1 Adenylate kinase OS=Flavobacterium johnsoniae (strain ATCC 17061 / DSM 2064 / UW101) GN=adk PE=3 SV=1 149 325 4.0E-25
sp|Q9RSK7|KAD_DEIRA Adenylate kinase OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=adk PE=3 SV=1 145 326 5.0E-25
sp|B4SI37|KAD_STRM5 Adenylate kinase OS=Stenotrophomonas maltophilia (strain R551-3) GN=adk PE=3 SV=1 149 334 9.0E-25
sp|Q7UN00|KAD_RHOBA Adenylate kinase OS=Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1) GN=adk PE=3 SV=2 148 327 1.0E-24
sp|C3PL31|KAD_CORA7 Adenylate kinase OS=Corynebacterium aurimucosum (strain ATCC 700975 / DSM 44827 / CN-1) GN=adk PE=3 SV=1 151 338 2.0E-24
sp|B0RP52|KAD_XANCB Adenylate kinase OS=Xanthomonas campestris pv. campestris (strain B100) GN=adk PE=3 SV=1 149 338 4.0E-24
sp|A6GZB9|KAD_FLAPJ Adenylate kinase OS=Flavobacterium psychrophilum (strain JIP02/86 / ATCC 49511) GN=adk PE=3 SV=1 149 307 4.0E-24
sp|P73302|KAD1_SYNY3 Adenylate kinase 1 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=adk1 PE=3 SV=2 149 334 5.0E-24
sp|A5GIS6|KAD_SYNPW Adenylate kinase OS=Synechococcus sp. (strain WH7803) GN=adk PE=3 SV=1 145 333 5.0E-24
sp|O66490|KAD_AQUAE Adenylate kinase OS=Aquifex aeolicus (strain VF5) GN=adk PE=1 SV=1 148 339 7.0E-24
sp|B9L9Y8|KAD_NAUPA Adenylate kinase OS=Nautilia profundicola (strain ATCC BAA-1463 / DSM 18972 / AmH) GN=adk PE=3 SV=1 150 338 7.0E-24
sp|B1VEX6|KAD_CORU7 Adenylate kinase OS=Corynebacterium urealyticum (strain ATCC 43042 / DSM 7109) GN=adk PE=3 SV=1 149 329 8.0E-24
sp|Q3IMW0|KAD_NATPD Adenylate kinase OS=Natronomonas pharaonis (strain ATCC 35678 / DSM 2160) GN=adk1 PE=3 SV=1 149 337 1.0E-23
sp|B9DSX1|KAD_STRU0 Adenylate kinase OS=Streptococcus uberis (strain ATCC BAA-854 / 0140J) GN=adk PE=3 SV=1 149 334 1.0E-23
sp|Q47LL4|KAD_THEFY Adenylate kinase OS=Thermobifida fusca (strain YX) GN=adk PE=3 SV=1 149 336 2.0E-23
sp|Q8P5P5|KAD_XANCP Adenylate kinase OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=adk PE=3 SV=1 149 338 2.0E-23
sp|Q4UYC6|KAD_XANC8 Adenylate kinase OS=Xanthomonas campestris pv. campestris (strain 8004) GN=adk PE=3 SV=1 149 338 2.0E-23
sp|Q5UXG8|KAD_HALMA Adenylate kinase OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=adk PE=3 SV=1 149 334 2.0E-23
sp|B0K5R3|KAD_THEPX Adenylate kinase OS=Thermoanaerobacter sp. (strain X514) GN=adk PE=3 SV=1 149 336 3.0E-23
sp|B0KCM0|KAD_THEP3 Adenylate kinase OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) GN=adk PE=3 SV=1 149 336 3.0E-23
sp|Q2JV96|KAD_SYNJA Adenylate kinase OS=Synechococcus sp. (strain JA-3-3Ab) GN=adk PE=3 SV=1 149 325 5.0E-23
sp|A8MLG1|KAD_ALKOO Adenylate kinase OS=Alkaliphilus oremlandii (strain OhILAs) GN=adk PE=3 SV=1 149 327 5.0E-23
sp|Q46GB9|KAD_METBF Adenylate kinase OS=Methanosarcina barkeri (strain Fusaro / DSM 804) GN=adk PE=3 SV=1 149 335 6.0E-23
sp|Q4UMQ8|KAD_RICFE Adenylate kinase OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=adk PE=3 SV=1 148 334 6.0E-23
sp|Q1IX93|KAD_DEIGD Adenylate kinase OS=Deinococcus geothermalis (strain DSM 11300) GN=adk PE=3 SV=1 141 326 2.0E-22
sp|Q8TRS3|KAD_METAC Adenylate kinase OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=adk PE=3 SV=1 149 333 2.0E-22
sp|C4LL05|KAD_CORK4 Adenylate kinase OS=Corynebacterium kroppenstedtii (strain DSM 44385 / CCUG 35717) GN=adk PE=3 SV=1 149 334 2.0E-22
sp|Q3BPM9|KAD_XANC5 Adenylate kinase OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=adk PE=3 SV=1 149 333 2.0E-22
sp|Q8PH23|KAD_XANAC Adenylate kinase OS=Xanthomonas axonopodis pv. citri (strain 306) GN=adk PE=3 SV=1 149 333 2.0E-22
sp|Q8VYL1|KAD5_ARATH Adenylate kinase 5, chloroplastic OS=Arabidopsis thaliana GN=At5g35170 PE=1 SV=1 134 335 2.0E-22
sp|Q9ZCS6|KAD_RICPR Adenylate kinase OS=Rickettsia prowazekii (strain Madrid E) GN=adk PE=3 SV=1 148 334 2.0E-22
sp|Q5H4A4|KAD_XANOR Adenylate kinase OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=adk PE=3 SV=1 149 333 2.0E-22
sp|Q2P743|KAD_XANOM Adenylate kinase OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=adk PE=3 SV=1 149 333 2.0E-22
sp|C3PP86|KAD_RICAE Adenylate kinase OS=Rickettsia africae (strain ESF-5) GN=adk PE=3 SV=1 148 334 2.0E-22
sp|A2CC47|KAD_PROM3 Adenylate kinase OS=Prochlorococcus marinus (strain MIT 9303) GN=adk PE=3 SV=1 149 333 2.0E-22
sp|A4J592|KAD_DESRM Adenylate kinase OS=Desulfotomaculum reducens (strain MI-1) GN=adk PE=3 SV=1 149 325 3.0E-22
sp|Q92GY7|KAD_RICCN Adenylate kinase OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=adk PE=3 SV=1 148 334 4.0E-22
sp|Q6ZC69|KAD2_ORYSJ Probable adenylate kinase 2, chloroplastic OS=Oryza sativa subsp. japonica GN=Os08g0109300 PE=2 SV=1 149 337 4.0E-22
sp|Q7V9Y1|KAD_PROMA Adenylate kinase OS=Prochlorococcus marinus (strain SARG / CCMP1375 / SS120) GN=adk PE=3 SV=1 149 337 4.0E-22
sp|P27142|KAD_GEOSE Adenylate kinase OS=Geobacillus stearothermophilus GN=adk PE=1 SV=1 149 333 4.0E-22
sp|B2FT48|KAD_STRMK Adenylate kinase OS=Stenotrophomonas maltophilia (strain K279a) GN=adk PE=3 SV=1 149 334 5.0E-22
sp|Q9WUR9|KAD4_MOUSE Adenylate kinase 4, mitochondrial OS=Mus musculus GN=Ak4 PE=1 SV=1 151 319 6.0E-22
sp|B8HMS3|KAD_CYAP4 Adenylate kinase OS=Cyanothece sp. (strain PCC 7425 / ATCC 29141) GN=adk PE=3 SV=1 149 341 6.0E-22
sp|Q8PV26|KAD_METMA Adenylate kinase OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=adk PE=3 SV=1 149 333 6.0E-22
sp|P38372|KAD_BACHD Adenylate kinase OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=adk PE=3 SV=2 149 334 8.0E-22
sp|A7Z0Q9|KAD_BACMF Adenylate kinase OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=adk PE=3 SV=1 149 338 1.0E-21
sp|C5D3T8|KAD_GEOSW Adenylate kinase OS=Geobacillus sp. (strain WCH70) GN=adk PE=3 SV=1 149 333 1.0E-21
sp|Q46IS8|KAD_PROMT Adenylate kinase OS=Prochlorococcus marinus (strain NATL2A) GN=adk PE=3 SV=1 149 333 1.0E-21
sp|A8F9A6|KAD_BACP2 Adenylate kinase OS=Bacillus pumilus (strain SAFR-032) GN=adk PE=3 SV=1 149 333 1.0E-21
sp|C0ZW47|KAD_RHOE4 Adenylate kinase OS=Rhodococcus erythropolis (strain PR4 / NBRC 100887) GN=adk PE=3 SV=1 149 327 1.0E-21
sp|P65204|KAD_STRA5 Adenylate kinase OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=adk PE=3 SV=1 149 335 1.0E-21
sp|P65203|KAD_STRA3 Adenylate kinase OS=Streptococcus agalactiae serotype III (strain NEM316) GN=adk PE=3 SV=1 149 335 1.0E-21
sp|Q8R7X4|KAD_CALS4 Adenylate kinase OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=adk PE=3 SV=1 149 339 1.0E-21
sp|Q5WLP1|KAD_BACSK Adenylate kinase OS=Bacillus clausii (strain KSM-K16) GN=adk PE=3 SV=1 149 336 1.0E-21
sp|B1MVZ4|KAD_LEUCK Adenylate kinase OS=Leuconostoc citreum (strain KM20) GN=adk PE=3 SV=1 146 333 1.0E-21
sp|Q68W99|KAD_RICTY Adenylate kinase OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) GN=adk PE=3 SV=1 148 334 1.0E-21
sp|Q1BD73|KAD_MYCSS Adenylate kinase OS=Mycobacterium sp. (strain MCS) GN=adk PE=3 SV=1 149 333 2.0E-21
sp|A1UBR9|KAD_MYCSK Adenylate kinase OS=Mycobacterium sp. (strain KMS) GN=adk PE=3 SV=1 149 333 2.0E-21
sp|A3PVF5|KAD_MYCSJ Adenylate kinase OS=Mycobacterium sp. (strain JLS) GN=adk PE=3 SV=1 149 333 2.0E-21
sp|Q03ZM5|KAD_LEUMM Adenylate kinase OS=Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / NCDO 523) GN=adk PE=3 SV=1 149 333 2.0E-21
sp|B0SSF7|KAD_LEPBP Adenylate kinase OS=Leptospira biflexa serovar Patoc (strain Patoc 1 / ATCC 23582 / Paris) GN=adk PE=3 SV=1 149 325 2.0E-21
sp|B0SA26|KAD_LEPBA Adenylate kinase OS=Leptospira biflexa serovar Patoc (strain Patoc 1 / Ames) GN=adk PE=3 SV=1 149 325 2.0E-21
sp|C4K2F8|KAD_RICPU Adenylate kinase OS=Rickettsia peacockii (strain Rustic) GN=adk PE=3 SV=1 148 334 2.0E-21
sp|A5UAD6|KAD_HAEIE Adenylate kinase OS=Haemophilus influenzae (strain PittEE) GN=adk PE=3 SV=1 149 333 2.0E-21
sp|Q5Z1Q1|KAD_NOCFA Adenylate kinase OS=Nocardia farcinica (strain IFM 10152) GN=adk PE=3 SV=1 149 325 2.0E-21
sp|Q7UZW3|KAD_PROMP Adenylate kinase OS=Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / MED4) GN=adk PE=3 SV=1 149 333 2.0E-21
sp|Q7V526|KAD_PROMM Adenylate kinase OS=Prochlorococcus marinus (strain MIT 9313) GN=adk PE=3 SV=1 149 333 2.0E-21
sp|C1CPA9|KAD_STRZT Adenylate kinase OS=Streptococcus pneumoniae (strain Taiwan19F-14) GN=adk PE=3 SV=1 149 333 2.0E-21
sp|C1CIB8|KAD_STRZP Adenylate kinase OS=Streptococcus pneumoniae (strain P1031) GN=adk PE=3 SV=1 149 333 2.0E-21
sp|C1CC27|KAD_STRZJ Adenylate kinase OS=Streptococcus pneumoniae (strain JJA) GN=adk PE=3 SV=1 149 333 2.0E-21
sp|Q8DRD4|KAD_STRR6 Adenylate kinase OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=adk PE=3 SV=1 149 333 2.0E-21
sp|B8ZKQ1|KAD_STRPJ Adenylate kinase OS=Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1) GN=adk PE=3 SV=1 149 333 2.0E-21
sp|B1I8L9|KAD_STRPI Adenylate kinase OS=Streptococcus pneumoniae (strain Hungary19A-6) GN=adk PE=3 SV=1 149 333 2.0E-21
sp|Q04ML5|KAD_STRP2 Adenylate kinase OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=adk PE=1 SV=1 149 333 2.0E-21
sp|B4U765|KAD_HYDS0 Adenylate kinase OS=Hydrogenobaculum sp. (strain Y04AAS1) GN=adk PE=3 SV=1 148 333 2.0E-21
sp|B2IS63|KAD_STRPS Adenylate kinase OS=Streptococcus pneumoniae (strain CGSP14) GN=adk PE=3 SV=1 149 333 3.0E-21
sp|Q97SU1|KAD_STRPN Adenylate kinase OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=adk PE=1 SV=1 149 333 3.0E-21
sp|B5E6H6|KAD_STRP4 Adenylate kinase OS=Streptococcus pneumoniae serotype 19F (strain G54) GN=adk PE=3 SV=1 149 333 3.0E-21
sp|P69882|KAD_STRP1 Adenylate kinase OS=Streptococcus pyogenes serotype M1 GN=adk PE=3 SV=1 149 335 3.0E-21
sp|A3CK85|KAD_STRSV Adenylate kinase OS=Streptococcus sanguinis (strain SK36) GN=adk PE=3 SV=1 149 333 3.0E-21
sp|Q8SVC2|KAD_ENCCU Adenylate kinase OS=Encephalitozoon cuniculi (strain GB-M1) GN=ECU06_0650 PE=1 SV=2 145 334 3.0E-21
sp|A2BYR7|KAD_PROM5 Adenylate kinase OS=Prochlorococcus marinus (strain MIT 9515) GN=adk PE=3 SV=1 149 333 3.0E-21
sp|C1CAN3|KAD_STRP7 Adenylate kinase OS=Streptococcus pneumoniae (strain 70585) GN=adk PE=3 SV=1 149 333 3.0E-21
sp|B1HMV9|KAD_LYSSC Adenylate kinase OS=Lysinibacillus sphaericus (strain C3-41) GN=adk PE=3 SV=1 149 334 3.0E-21
sp|P0DB93|KAD_STRPQ Adenylate kinase OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=adk PE=3 SV=1 149 335 4.0E-21
sp|Q1J8Z2|KAD_STRPF Adenylate kinase OS=Streptococcus pyogenes serotype M4 (strain MGAS10750) GN=adk PE=3 SV=1 149 335 4.0E-21
sp|P0DB92|KAD_STRP3 Adenylate kinase OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=adk PE=3 SV=1 149 335 4.0E-21
sp|P65202|KAD_STAAW Adenylate kinase OS=Staphylococcus aureus (strain MW2) GN=adk PE=3 SV=1 149 321 4.0E-21
sp|Q6G792|KAD_STAAS Adenylate kinase OS=Staphylococcus aureus (strain MSSA476) GN=adk PE=3 SV=1 149 321 4.0E-21
sp|Q6GEK4|KAD_STAAR Adenylate kinase OS=Staphylococcus aureus (strain MRSA252) GN=adk PE=3 SV=1 149 321 4.0E-21
sp|P99062|KAD_STAAN Adenylate kinase OS=Staphylococcus aureus (strain N315) GN=adk PE=1 SV=1 149 321 4.0E-21
sp|P65201|KAD_STAAM Adenylate kinase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=adk PE=3 SV=1 149 321 4.0E-21
sp|Q5HDX9|KAD_STAAC Adenylate kinase OS=Staphylococcus aureus (strain COL) GN=adk PE=3 SV=1 149 321 4.0E-21
sp|B5XJ57|KAD_STRPZ Adenylate kinase OS=Streptococcus pyogenes serotype M49 (strain NZ131) GN=adk PE=3 SV=1 149 335 4.0E-21
sp|Q48VS8|KAD_STRPM Adenylate kinase OS=Streptococcus pyogenes serotype M28 (strain MGAS6180) GN=adk PE=3 SV=1 149 335 4.0E-21
sp|Q1JJ40|KAD_STRPD Adenylate kinase OS=Streptococcus pyogenes serotype M2 (strain MGAS10270) GN=adk PE=3 SV=1 149 335 4.0E-21
sp|Q1JNZ6|KAD_STRPC Adenylate kinase OS=Streptococcus pyogenes serotype M12 (strain MGAS9429) GN=adk PE=3 SV=1 149 335 4.0E-21
sp|Q1JE38|KAD_STRPB Adenylate kinase OS=Streptococcus pyogenes serotype M12 (strain MGAS2096) GN=adk PE=3 SV=1 149 335 4.0E-21
sp|Q8P2Z4|KAD_STRP8 Adenylate kinase OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=adk PE=3 SV=1 149 335 4.0E-21
sp|Q04G65|KAD_OENOB Adenylate kinase OS=Oenococcus oeni (strain ATCC BAA-331 / PSU-1) GN=adk PE=3 SV=1 149 331 4.0E-21
sp|A8GT48|KAD_RICRS Adenylate kinase OS=Rickettsia rickettsii (strain Sheila Smith) GN=adk PE=3 SV=1 148 334 4.0E-21
sp|B0BUN9|KAD_RICRO Adenylate kinase OS=Rickettsia rickettsii (strain Iowa) GN=adk PE=3 SV=1 148 334 4.0E-21
sp|A8GPC9|KAD_RICAH Adenylate kinase OS=Rickettsia akari (strain Hartford) GN=adk PE=3 SV=1 148 334 4.0E-21
sp|Q3AW74|KAD_SYNS9 Adenylate kinase OS=Synechococcus sp. (strain CC9902) GN=adk PE=3 SV=1 149 333 4.0E-21
sp|P61115|KAD_BDEBA Adenylate kinase OS=Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIB 9529 / HD100) GN=adk PE=3 SV=1 149 334 4.0E-21
sp|B2A4G2|KAD_NATTJ Adenylate kinase OS=Natranaerobius thermophilus (strain ATCC BAA-1301 / DSM 18059 / JW/NM-WN-LF) GN=adk PE=3 SV=1 149 336 5.0E-21
sp|Q0VCP1|KAD4_BOVIN Adenylate kinase 4, mitochondrial OS=Bos taurus GN=AK4 PE=2 SV=1 151 319 5.0E-21
sp|P43188|KADC_MAIZE Adenylate kinase, chloroplastic OS=Zea mays GN=ADK1 PE=1 SV=1 149 333 5.0E-21
sp|Q83M40|KAD_SHIFL Adenylate kinase OS=Shigella flexneri GN=adk PE=3 SV=4 149 333 5.0E-21
sp|Q4JTB5|KAD_CORJK Adenylate kinase OS=Corynebacterium jeikeium (strain K411) GN=adk PE=3 SV=1 149 335 5.0E-21
sp|Q9FIJ7|KAD2_ARATH Adenylate kinase 2, chloroplastic OS=Arabidopsis thaliana GN=At5g47840 PE=1 SV=1 149 337 6.0E-21
sp|O29581|KAD_ARCFU Adenylate kinase OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=adk PE=3 SV=1 149 330 7.0E-21
sp|Q0J6P7|KAD5_ORYSJ Probable adenylate kinase 5, chloroplastic OS=Oryza sativa subsp. japonica GN=Os08g0288200 PE=2 SV=2 149 335 7.0E-21
sp|P24323|KAD_HAEIN Adenylate kinase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=adk PE=3 SV=2 149 333 7.0E-21
sp|A5UGF8|KAD_HAEIG Adenylate kinase OS=Haemophilus influenzae (strain PittGG) GN=adk PE=3 SV=1 149 333 7.0E-21
sp|Q4QNJ1|KAD_HAEI8 Adenylate kinase OS=Haemophilus influenzae (strain 86-028NP) GN=adk PE=3 SV=1 149 333 7.0E-21
sp|Q5R421|KAD4_PONAB Adenylate kinase 4, mitochondrial OS=Pongo abelii GN=AK4 PE=2 SV=1 151 319 7.0E-21
sp|P27144|KAD4_HUMAN Adenylate kinase 4, mitochondrial OS=Homo sapiens GN=AK4 PE=1 SV=1 151 319 7.0E-21
sp|Q65UF7|KAD_MANSM Adenylate kinase OS=Mannheimia succiniciproducens (strain MBEL55E) GN=adk PE=3 SV=1 149 328 8.0E-21
sp|A2C4Y0|KAD_PROM1 Adenylate kinase OS=Prochlorococcus marinus (strain NATL1A) GN=adk PE=3 SV=1 149 333 8.0E-21
sp|A8EZJ5|KAD_RICCK Adenylate kinase OS=Rickettsia canadensis (strain McKiel) GN=adk PE=3 SV=1 148 334 8.0E-21
sp|Q6NJ71|KAD_CORDI Adenylate kinase OS=Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis) GN=adk PE=3 SV=1 149 329 9.0E-21
sp|O96907|KAD_ENTHI Adenylate kinase OS=Entamoeba histolytica PE=3 SV=1 149 296 9.0E-21
sp|Q9WUS0|KAD4_RAT Adenylate kinase 4, mitochondrial OS=Rattus norvegicus GN=Ak4 PE=2 SV=1 151 319 9.0E-21
sp|Q18CH9|KAD_PEPD6 Adenylate kinase OS=Peptoclostridium difficile (strain 630) GN=adk PE=3 SV=1 149 328 9.0E-21
sp|Q0T7B1|KAD_SHIF8 Adenylate kinase OS=Shigella flexneri serotype 5b (strain 8401) GN=adk PE=3 SV=1 149 333 1.0E-20
sp|Q325C2|KAD_SHIBS Adenylate kinase OS=Shigella boydii serotype 4 (strain Sb227) GN=adk PE=3 SV=1 149 333 1.0E-20
sp|B2U4S7|KAD_SHIB3 Adenylate kinase OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=adk PE=3 SV=1 149 333 1.0E-20
sp|B7LV13|KAD_ESCF3 Adenylate kinase OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=adk PE=3 SV=1 149 333 1.0E-20
sp|B1LJN2|KAD_ECOSM Adenylate kinase OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=adk PE=3 SV=1 149 333 1.0E-20
sp|B6I0C6|KAD_ECOSE Adenylate kinase OS=Escherichia coli (strain SE11) GN=adk PE=3 SV=1 149 333 1.0E-20
sp|B7N927|KAD_ECOLU Adenylate kinase OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=adk PE=3 SV=1 149 333 1.0E-20
sp|P69441|KAD_ECOLI Adenylate kinase OS=Escherichia coli (strain K12) GN=adk PE=1 SV=1 149 333 1.0E-20
sp|B1IZC0|KAD_ECOLC Adenylate kinase OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=adk PE=3 SV=1 149 333 1.0E-20
sp|A7ZXD2|KAD_ECOHS Adenylate kinase OS=Escherichia coli O9:H4 (strain HS) GN=adk PE=3 SV=1 149 333 1.0E-20
sp|B1XFR1|KAD_ECODH Adenylate kinase OS=Escherichia coli (strain K12 / DH10B) GN=adk PE=3 SV=1 149 333 1.0E-20
sp|C4ZUS8|KAD_ECOBW Adenylate kinase OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=adk PE=3 SV=1 149 333 1.0E-20
sp|P69442|KAD_ECO57 Adenylate kinase OS=Escherichia coli O157:H7 GN=adk PE=3 SV=1 149 333 1.0E-20
sp|B7L799|KAD_ECO55 Adenylate kinase OS=Escherichia coli (strain 55989 / EAEC) GN=adk PE=3 SV=1 149 333 1.0E-20
sp|A7ZIN4|KAD_ECO24 Adenylate kinase OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=adk PE=3 SV=1 149 333 1.0E-20
sp|B6YRA7|KAD_AZOPC Adenylate kinase OS=Azobacteroides pseudotrichonymphae genomovar. CFP2 GN=adk PE=3 SV=1 151 326 1.0E-20
sp|A5CU93|KAD_CLAM3 Adenylate kinase OS=Clavibacter michiganensis subsp. michiganensis (strain NCPPB 382) GN=adk PE=3 SV=1 147 325 1.0E-20
sp|Q73S77|KAD_MYCPA Adenylate kinase OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=adk PE=3 SV=1 149 327 1.0E-20
sp|Q2JIK8|KAD_SYNJB Adenylate kinase OS=Synechococcus sp. (strain JA-2-3B'a(2-13)) GN=adk PE=3 SV=1 149 334 1.0E-20
sp|Q32J54|KAD_SHIDS Adenylate kinase OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=adk PE=3 SV=1 149 333 1.0E-20
sp|Q3K3U8|KAD_STRA1 Adenylate kinase OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) GN=adk PE=3 SV=1 149 335 1.0E-20
sp|Q9A8T2|KAD_CAUCR Adenylate kinase OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=adk PE=3 SV=1 149 334 1.0E-20
sp|B8H4F5|KAD_CAUCN Adenylate kinase OS=Caulobacter crescentus (strain NA1000 / CB15N) GN=adk PE=3 SV=1 149 334 1.0E-20
sp|Q3Z4S5|KAD_SHISS Adenylate kinase OS=Shigella sonnei (strain Ss046) GN=adk PE=3 SV=1 149 333 2.0E-20
sp|Q8DS33|KAD_STRMU Adenylate kinase OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=adk PE=3 SV=1 149 333 2.0E-20
sp|B8DB29|KAD_LISMH Adenylate kinase OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=adk PE=3 SV=1 149 333 2.0E-20
sp|Q1RHP2|KAD_RICBR Adenylate kinase OS=Rickettsia bellii (strain RML369-C) GN=adk PE=3 SV=1 148 334 2.0E-20
sp|Q0AUK1|KAD_SYNWW Adenylate kinase OS=Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen) GN=adk PE=3 SV=1 149 334 2.0E-20
sp|B1MGB3|KAD_MYCA9 Adenylate kinase OS=Mycobacterium abscessus (strain ATCC 19977 / DSM 44196 / CIP 104536 / JCM 13569 / NCTC 13031 / TMC 1543) GN=adk PE=3 SV=1 149 333 2.0E-20
sp|Q0ID24|KAD_SYNS3 Adenylate kinase OS=Synechococcus sp. (strain CC9311) GN=adk PE=3 SV=1 149 325 2.0E-20
sp|Q8FK84|KAD_ECOL6 Adenylate kinase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=adk PE=3 SV=2 149 333 2.0E-20
sp|Q0TKG7|KAD_ECOL5 Adenylate kinase OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=adk PE=3 SV=1 149 333 2.0E-20
sp|B7MQI9|KAD_ECO81 Adenylate kinase OS=Escherichia coli O81 (strain ED1a) GN=adk PE=3 SV=1 149 333 2.0E-20
sp|B7NIF6|KAD_ECO7I Adenylate kinase OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=adk PE=3 SV=1 149 333 2.0E-20
sp|B7UKF4|KAD_ECO27 Adenylate kinase OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=adk PE=3 SV=1 149 333 2.0E-20
sp|A8GAV3|KAD_SERP5 Adenylate kinase OS=Serratia proteamaculans (strain 568) GN=adk PE=3 SV=1 149 328 3.0E-20
sp|A6VQC3|KAD_ACTSZ Adenylate kinase OS=Actinobacillus succinogenes (strain ATCC 55618 / 130Z) GN=adk PE=3 SV=1 149 333 3.0E-20
sp|A9BCM8|KAD_PROM4 Adenylate kinase OS=Prochlorococcus marinus (strain MIT 9211) GN=adk PE=3 SV=1 145 325 3.0E-20
sp|C0M6X3|KAD_STRE4 Adenylate kinase OS=Streptococcus equi subsp. equi (strain 4047) GN=adk PE=3 SV=1 149 334 3.0E-20
sp|C0ME26|KAD_STRS7 Adenylate kinase OS=Streptococcus equi subsp. zooepidemicus (strain H70) GN=adk PE=3 SV=1 149 334 3.0E-20
sp|B7MDZ6|KAD_ECO45 Adenylate kinase OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=adk PE=3 SV=1 149 333 3.0E-20
sp|B9K8A7|KAD_THENN Adenylate kinase OS=Thermotoga neapolitana (strain ATCC 49049 / DSM 4359 / NS-E) GN=adk PE=3 SV=1 146 331 4.0E-20
sp|Q8GGL2|KAD_THENE Adenylate kinase OS=Thermotoga neapolitana GN=adk PE=3 SV=1 146 331 4.0E-20
sp|A6T5N7|KAD_KLEP7 Adenylate kinase OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=adk PE=3 SV=1 149 333 4.0E-20
sp|B5Y0N3|KAD_KLEP3 Adenylate kinase OS=Klebsiella pneumoniae (strain 342) GN=adk PE=3 SV=1 149 333 4.0E-20
sp|B1LBL9|KAD_THESQ Adenylate kinase OS=Thermotoga sp. (strain RQ2) GN=adk PE=3 SV=1 146 331 4.0E-20
sp|A5IMA4|KAD_THEP1 Adenylate kinase OS=Thermotoga petrophila (strain RKU-1 / ATCC BAA-488 / DSM 13995) GN=adk PE=3 SV=1 146 331 4.0E-20
sp|Q5XEB4|KAD_STRP6 Adenylate kinase OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=adk PE=1 SV=1 149 335 4.0E-20
sp|Q8CRI0|KAD_STAES Adenylate kinase OS=Staphylococcus epidermidis (strain ATCC 12228) GN=adk PE=3 SV=1 149 325 4.0E-20
sp|Q5HM20|KAD_STAEQ Adenylate kinase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=adk PE=3 SV=1 149 325 4.0E-20
sp|A2RC35|KAD_STRPG Adenylate kinase OS=Streptococcus pyogenes serotype M5 (strain Manfredo) GN=adk PE=3 SV=1 149 335 4.0E-20
sp|B4R8N8|KAD_PHEZH Adenylate kinase OS=Phenylobacterium zucineum (strain HLK1) GN=adk PE=3 SV=1 149 327 4.0E-20
sp|Q71WG7|KAD_LISMF Adenylate kinase OS=Listeria monocytogenes serotype 4b (strain F2365) GN=adk PE=3 SV=1 149 333 4.0E-20
sp|C1KZF9|KAD_LISMC Adenylate kinase OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=adk PE=3 SV=1 149 333 4.0E-20
sp|A3DJJ3|KAD_CLOTH Adenylate kinase OS=Clostridium thermocellum (strain ATCC 27405 / DSM 1237 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) GN=adk PE=3 SV=1 149 333 5.0E-20
sp|A7HWT2|KAD_PARL1 Adenylate kinase OS=Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966) GN=adk PE=3 SV=1 149 333 5.0E-20
sp|Q6A6Q4|KAD_PROAC Adenylate kinase OS=Propionibacterium acnes (strain KPA171202 / DSM 16379) GN=adk PE=3 SV=1 149 325 5.0E-20
sp|Q04PV9|KAD_LEPBJ Adenylate kinase OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) GN=adk PE=3 SV=1 149 333 5.0E-20
sp|P16304|KAD_BACSU Adenylate kinase OS=Bacillus subtilis (strain 168) GN=adk PE=1 SV=2 149 333 5.0E-20
sp|Q6AD15|KAD_LEIXX Adenylate kinase OS=Leifsonia xyli subsp. xyli (strain CTCB07) GN=adk PE=3 SV=1 149 318 6.0E-20
sp|P33107|KAD_MICLU Adenylate kinase OS=Micrococcus luteus GN=adk PE=3 SV=1 147 319 6.0E-20
sp|C5CC42|KAD_MICLC Adenylate kinase OS=Micrococcus luteus (strain ATCC 4698 / DSM 20030 / JCM 1464 / NBRC 3333 / NCIMB 9278 / NCTC 2665 / VKM Ac-2230) GN=adk PE=3 SV=1 147 319 6.0E-20
sp|C5BD16|KAD_EDWI9 Adenylate kinase OS=Edwardsiella ictaluri (strain 93-146) GN=adk PE=3 SV=1 149 333 6.0E-20
sp|Q890Q5|KAD_CLOTE Adenylate kinase OS=Clostridium tetani (strain Massachusetts / E88) GN=adk PE=3 SV=1 149 326 7.0E-20
sp|Q8EUD3|KAD_MYCPE Adenylate kinase OS=Mycoplasma penetrans (strain HF-2) GN=adk PE=3 SV=1 149 320 7.0E-20
sp|Q8Y449|KAD_LISMO Adenylate kinase OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=adk PE=3 SV=1 149 333 7.0E-20
sp|A8AJW9|KAD_CITK8 Adenylate kinase OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=adk PE=3 SV=1 149 333 8.0E-20
sp|B0TC77|KAD_HELMI Adenylate kinase OS=Heliobacterium modesticaldum (strain ATCC 51547 / Ice1) GN=adk PE=3 SV=1 149 328 8.0E-20
sp|Q9X1I8|KAD_THEMA Adenylate kinase OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=adk PE=3 SV=1 146 331 8.0E-20
sp|C4ZBT9|KAD_EUBR3 Adenylate kinase OS=Eubacterium rectale (strain ATCC 33656 / VPI 0990) GN=adk PE=3 SV=1 149 335 8.0E-20
sp|Q7U4I1|KAD_SYNPX Adenylate kinase OS=Synechococcus sp. (strain WH8102) GN=adk PE=3 SV=1 145 333 8.0E-20
sp|A4IJK9|KAD_GEOTN Adenylate kinase OS=Geobacillus thermodenitrificans (strain NG80-2) GN=adk PE=3 SV=1 149 333 8.0E-20
sp|B7M3W6|KAD_ECO8A Adenylate kinase OS=Escherichia coli O8 (strain IAI1) GN=adk PE=3 SV=1 149 333 9.0E-20
sp|B0T2E3|KAD_CAUSK Adenylate kinase OS=Caulobacter sp. (strain K31) GN=adk PE=3 SV=1 149 325 9.0E-20
sp|A4VSH4|KAD_STRSY Adenylate kinase OS=Streptococcus suis (strain 05ZYH33) GN=adk PE=3 SV=1 149 326 1.0E-19
sp|A4VYR4|KAD_STRS2 Adenylate kinase OS=Streptococcus suis (strain 98HAH33) GN=adk PE=3 SV=1 149 326 1.0E-19
sp|Q15RT7|KAD_PSEA6 Adenylate kinase OS=Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087) GN=adk PE=3 SV=1 149 319 1.0E-19
sp|B2HCV5|KAD_MYCMM Adenylate kinase OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=adk PE=3 SV=1 149 327 1.0E-19
sp|A4W7F8|KAD_ENT38 Adenylate kinase OS=Enterobacter sp. (strain 638) GN=adk PE=3 SV=1 149 333 1.0E-19
sp|B2KEK1|KAD_ELUMP Adenylate kinase OS=Elusimicrobium minutum (strain Pei191) GN=adk PE=3 SV=1 148 336 1.0E-19
sp|A0PM98|KAD_MYCUA Adenylate kinase OS=Mycobacterium ulcerans (strain Agy99) GN=adk PE=3 SV=1 149 327 1.0E-19
sp|Q839E3|KAD_ENTFA Adenylate kinase OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=adk PE=3 SV=1 149 335 1.0E-19
sp|Q927M8|KAD_LISIN Adenylate kinase OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=adk PE=3 SV=1 149 333 1.0E-19
sp|Q12ZS7|KAD_METBU Adenylate kinase OS=Methanococcoides burtonii (strain DSM 6242 / NBRC 107633 / OCM 468 / ACE-M) GN=adk PE=3 SV=1 149 335 1.0E-19
sp|A8AZK4|KAD_STRGC Adenylate kinase OS=Streptococcus gordonii (strain Challis / ATCC 35105 / CH1 / DL1 / V288) GN=adk PE=3 SV=1 149 337 1.0E-19
sp|Q1LTX5|KAD_BAUCH Adenylate kinase OS=Baumannia cicadellinicola subsp. Homalodisca coagulata GN=adk PE=3 SV=1 149 308 1.0E-19
sp|P33075|KAD2_SCHPO Adenylate kinase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=adk1 PE=1 SV=1 149 328 2.0E-19
sp|P49974|KAD_STRLI Adenylate kinase (Fragment) OS=Streptomyces lividans GN=adk PE=3 SV=1 149 319 2.0E-19
sp|A0ALU7|KAD_LISW6 Adenylate kinase OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=adk PE=3 SV=1 149 333 2.0E-19
sp|A9H3J9|KAD_GLUDA Adenylate kinase OS=Gluconacetobacter diazotrophicus (strain ATCC 49037 / DSM 5601 / PAl5) GN=adk PE=3 SV=1 149 329 2.0E-19
sp|Q02W46|KAD_LACLS Adenylate kinase OS=Lactococcus lactis subsp. cremoris (strain SK11) GN=adk PE=3 SV=1 149 333 2.0E-19
sp|A2RNN2|KAD_LACLM Adenylate kinase OS=Lactococcus lactis subsp. cremoris (strain MG1363) GN=adk PE=3 SV=1 149 333 2.0E-19
sp|P27143|KAD_LACLC Adenylate kinase OS=Lactococcus lactis subsp. cremoris GN=adk PE=3 SV=3 149 333 2.0E-19
sp|A4XLR0|KAD_CALS8 Adenylate kinase OS=Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331) GN=adk PE=3 SV=1 149 340 3.0E-19
sp|A7GK41|KAD_BACCN Adenylate kinase OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=adk PE=3 SV=1 149 328 3.0E-19
sp|A3PF28|KAD_PROM0 Adenylate kinase OS=Prochlorococcus marinus (strain MIT 9301) GN=adk PE=3 SV=1 149 333 3.0E-19
sp|B8IT32|KAD_METNO Adenylate kinase OS=Methylobacterium nodulans (strain ORS2060 / LMG 21967) GN=adk PE=3 SV=1 149 317 3.0E-19
sp|P58117|KAD_LACLA Adenylate kinase OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=adk PE=3 SV=1 149 333 4.0E-19
sp|P35140|KAD_BACLD Adenylate kinase OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=adk PE=3 SV=2 149 333 4.0E-19
sp|Q82DM5|KAD_STRAW Adenylate kinase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=adk PE=3 SV=1 149 334 4.0E-19
sp|P0A1V4|KAD_SALTY Adenylate kinase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=adk PE=3 SV=1 149 333 4.0E-19
sp|P0A1V5|KAD_SALTI Adenylate kinase OS=Salmonella typhi GN=adk PE=3 SV=1 149 333 4.0E-19
sp|B4TMG6|KAD_SALSV Adenylate kinase OS=Salmonella schwarzengrund (strain CVM19633) GN=adk PE=3 SV=1 149 333 4.0E-19
sp|B5BD44|KAD_SALPK Adenylate kinase OS=Salmonella paratyphi A (strain AKU_12601) GN=adk PE=3 SV=1 149 333 4.0E-19
sp|C0Q812|KAD_SALPC Adenylate kinase OS=Salmonella paratyphi C (strain RKS4594) GN=adk PE=3 SV=1 149 333 4.0E-19
sp|Q5PFK8|KAD_SALPA Adenylate kinase OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=adk PE=3 SV=1 149 333 4.0E-19
sp|B4SWY1|KAD_SALNS Adenylate kinase OS=Salmonella newport (strain SL254) GN=adk PE=3 SV=1 149 333 4.0E-19
sp|B4T9I1|KAD_SALHS Adenylate kinase OS=Salmonella heidelberg (strain SL476) GN=adk PE=3 SV=1 149 333 4.0E-19
sp|B5R612|KAD_SALG2 Adenylate kinase OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=adk PE=3 SV=1 149 333 4.0E-19
sp|B5QU77|KAD_SALEP Adenylate kinase OS=Salmonella enteritidis PT4 (strain P125109) GN=adk PE=3 SV=1 149 333 4.0E-19
sp|B5FLJ7|KAD_SALDC Adenylate kinase OS=Salmonella dublin (strain CT_02021853) GN=adk PE=3 SV=1 149 333 4.0E-19
sp|Q57S76|KAD_SALCH Adenylate kinase OS=Salmonella choleraesuis (strain SC-B67) GN=adk PE=3 SV=1 149 333 4.0E-19
sp|B5EXN0|KAD_SALA4 Adenylate kinase OS=Salmonella agona (strain SL483) GN=adk PE=3 SV=1 149 333 4.0E-19
sp|Q9XD15|KAD_LEPIN Adenylate kinase OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601) GN=adk PE=3 SV=2 149 333 4.0E-19
sp|Q72NI2|KAD_LEPIC Adenylate kinase OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130) GN=adk PE=3 SV=1 149 333 4.0E-19
sp|Q5RDZ0|KAD3_PONAB GTP:AMP phosphotransferase AK3, mitochondrial OS=Pongo abelii GN=AK3 PE=2 SV=3 151 333 5.0E-19
sp|Q9UIJ7|KAD3_HUMAN GTP:AMP phosphotransferase AK3, mitochondrial OS=Homo sapiens GN=AK3 PE=1 SV=4 151 336 5.0E-19
sp|P57837|KAD_PASMU Adenylate kinase OS=Pasteurella multocida (strain Pm70) GN=adk PE=3 SV=1 149 328 5.0E-19
sp|Q4WJ21|KAD2_ASPFU Adenylate kinase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=adk1 PE=3 SV=1 149 326 5.0E-19
sp|B0XPW9|KAD2_ASPFC Adenylate kinase OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=adk1 PE=3 SV=1 149 326 5.0E-19
sp|Q8ETW3|KAD_OCEIH Adenylate kinase OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=adk PE=3 SV=1 149 336 6.0E-19
sp|Q7VMY0|KAD_HAEDU Adenylate kinase OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=adk PE=3 SV=1 149 328 6.0E-19
sp|A8G742|KAD_PROM2 Adenylate kinase OS=Prochlorococcus marinus (strain MIT 9215) GN=adk PE=3 SV=1 149 333 6.0E-19
sp|A1VYZ9|KAD_CAMJJ Adenylate kinase OS=Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176) GN=adk PE=3 SV=1 150 335 7.0E-19
sp|A8FL60|KAD_CAMJ8 Adenylate kinase OS=Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828) GN=adk PE=3 SV=1 150 335 7.0E-19
sp|Q5REI7|KAD2_PONAB Adenylate kinase 2, mitochondrial OS=Pongo abelii GN=AK2 PE=2 SV=3 135 327 7.0E-19
sp|P54819|KAD2_HUMAN Adenylate kinase 2, mitochondrial OS=Homo sapiens GN=AK2 PE=1 SV=2 135 327 7.0E-19
sp|Q8YPJ8|KAD1_NOSS1 Adenylate kinase 1 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=adk1 PE=3 SV=1 147 338 9.0E-19
sp|Q9PHM8|KAD_CAMJE Adenylate kinase OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=adk PE=3 SV=1 150 335 9.0E-19
sp|A1D3M8|KAD2_NEOFI Adenylate kinase OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=adk1 PE=3 SV=1 149 326 9.0E-19
sp|A2BTB8|KAD_PROMS Adenylate kinase OS=Prochlorococcus marinus (strain AS9601) GN=adk PE=3 SV=1 149 333 9.0E-19
sp|B1Z772|KAD_METPB Adenylate kinase OS=Methylobacterium populi (strain ATCC BAA-705 / NCIMB 13946 / BJ001) GN=adk PE=3 SV=1 149 318 9.0E-19
sp|Q9PGM3|KAD_XYLFA Adenylate kinase OS=Xylella fastidiosa (strain 9a5c) GN=adk PE=3 SV=2 149 319 9.0E-19
sp|B7IT40|KAD_BACC2 Adenylate kinase OS=Bacillus cereus (strain G9842) GN=adk PE=3 SV=1 149 328 1.0E-18
sp|C4KZM5|KAD_EXISA Adenylate kinase OS=Exiguobacterium sp. (strain ATCC BAA-1283 / AT1b) GN=adk PE=3 SV=1 149 335 1.0E-18
sp|Q0ANS1|KAD_MARMM Adenylate kinase OS=Maricaulis maris (strain MCS10) GN=adk PE=3 SV=1 149 336 1.0E-18
sp|Q3ACG0|KAD_CARHZ Adenylate kinase OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=adk PE=3 SV=1 149 335 1.0E-18
sp|P08760|KAD3_BOVIN GTP:AMP phosphotransferase AK3, mitochondrial OS=Bos taurus GN=AK3 PE=1 SV=3 151 336 1.0E-18
sp|B0U1U0|KAD_XYLFM Adenylate kinase OS=Xylella fastidiosa (strain M12) GN=adk PE=3 SV=1 149 338 1.0E-18
sp|B2GJ13|KAD_KOCRD Adenylate kinase OS=Kocuria rhizophila (strain ATCC 9341 / DSM 348 / NBRC 103217 / DC2201) GN=adk PE=3 SV=1 147 318 1.0E-18
sp|Q3SSU5|KAD_NITWN Adenylate kinase OS=Nitrobacter winogradskyi (strain Nb-255 / ATCC 25391) GN=adk PE=3 SV=1 149 334 1.0E-18
sp|B1W3Y6|KAD_STRGG Adenylate kinase OS=Streptomyces griseus subsp. griseus (strain JCM 4626 / NBRC 13350) GN=adk PE=3 SV=1 149 334 1.0E-18
sp|B4MQT3|KAD2_DROWI Adenylate kinase OS=Drosophila willistoni GN=Adk2 PE=3 SV=1 150 328 1.0E-18
sp|B0UT69|KAD_HISS2 Adenylate kinase OS=Histophilus somni (strain 2336) GN=adk PE=3 SV=1 149 333 1.0E-18
sp|Q0I2Y5|KAD_HAES1 Adenylate kinase OS=Haemophilus somnus (strain 129Pt) GN=adk PE=3 SV=1 149 333 1.0E-18
sp|B6EHK0|KAD_ALISL Adenylate kinase OS=Aliivibrio salmonicida (strain LFI1238) GN=adk PE=3 SV=1 149 333 1.0E-18
sp|B9KFZ2|KAD_CAMLR Adenylate kinase OS=Campylobacter lari (strain RM2100 / D67 / ATCC BAA-1060) GN=adk PE=3 SV=1 150 337 1.0E-18
sp|B4RU55|KAD_ALTMD Adenylate kinase OS=Alteromonas macleodii (strain DSM 17117 / Deep ecotype) GN=adk PE=3 SV=1 149 333 1.0E-18
sp|A7H4H3|KAD_CAMJD Adenylate kinase OS=Campylobacter jejuni subsp. doylei (strain ATCC BAA-1458 / RM4099 / 269.97) GN=adk PE=3 SV=1 150 335 2.0E-18
sp|P43414|KAD_STRCO Adenylate kinase OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=adk PE=3 SV=3 149 319 2.0E-18
sp|Q87ES6|KAD_XYLFT Adenylate kinase OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=adk PE=3 SV=1 149 338 2.0E-18
sp|B2I757|KAD_XYLF2 Adenylate kinase OS=Xylella fastidiosa (strain M23) GN=adk PE=3 SV=1 149 338 2.0E-18
sp|Q7NKT5|KAD_GLOVI Adenylate kinase OS=Gloeobacter violaceus (strain PCC 7421) GN=adk PE=3 SV=1 149 338 2.0E-18
sp|Q5M2D4|KAD_STRT2 Adenylate kinase OS=Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311) GN=adk PE=3 SV=1 149 333 2.0E-18
sp|Q5LXT2|KAD_STRT1 Adenylate kinase OS=Streptococcus thermophilus (strain CNRZ 1066) GN=adk PE=3 SV=1 149 333 2.0E-18
sp|P9WKF5|KAD_MYCTU Adenylate kinase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=adk PE=1 SV=1 149 333 2.0E-18
sp|P9WKF4|KAD_MYCTO Adenylate kinase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=adk PE=3 SV=1 149 333 2.0E-18
sp|A5U0B9|KAD_MYCTA Adenylate kinase OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=adk PE=3 SV=1 149 333 2.0E-18
sp|C1AL67|KAD_MYCBT Adenylate kinase OS=Mycobacterium bovis (strain BCG / Tokyo 172 / ATCC 35737 / TMC 1019) GN=adk PE=3 SV=1 149 333 2.0E-18
sp|A1KGL4|KAD_MYCBP Adenylate kinase OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=adk PE=3 SV=1 149 333 2.0E-18
sp|P69439|KAD_MYCBO Adenylate kinase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=adk PE=3 SV=1 149 333 2.0E-18
sp|A7THY5|KAD2_VANPO Adenylate kinase OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=ADK1 PE=3 SV=1 149 333 3.0E-18
sp|Q8AVD3|KAD2_XENLA Adenylate kinase 2, mitochondrial OS=Xenopus laevis GN=ak2 PE=2 SV=1 150 327 3.0E-18
sp|B5YHP1|KAD_THEYD Adenylate kinase OS=Thermodesulfovibrio yellowstonii (strain ATCC 51303 / DSM 11347 / YP87) GN=adk PE=3 SV=1 148 326 3.0E-18
sp|A8XZJ0|KAD2_CAEBR Adenylate kinase OS=Caenorhabditis briggsae GN=let-754 PE=3 SV=2 136 318 3.0E-18
sp|Q5HVD2|KAD_CAMJR Adenylate kinase OS=Campylobacter jejuni (strain RM1221) GN=adk PE=3 SV=1 150 335 3.0E-18
sp|B5FBZ5|KAD_VIBFM Adenylate kinase OS=Vibrio fischeri (strain MJ11) GN=adk PE=3 SV=1 149 333 4.0E-18
sp|Q5E6Q8|KAD_VIBF1 Adenylate kinase OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=adk PE=3 SV=1 149 333 4.0E-18
sp|B9IZL5|KAD_BACCQ Adenylate kinase OS=Bacillus cereus (strain Q1) GN=adk PE=3 SV=1 149 328 4.0E-18
sp|B7HQW5|KAD_BACC7 Adenylate kinase OS=Bacillus cereus (strain AH187) GN=adk PE=3 SV=1 149 328 4.0E-18
sp|Q73F75|KAD_BACC1 Adenylate kinase OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=adk PE=3 SV=1 149 328 4.0E-18
sp|A9VP98|KAD_BACWK Adenylate kinase OS=Bacillus weihenstephanensis (strain KBAB4) GN=adk PE=3 SV=1 149 328 4.0E-18
sp|A1CQR5|KAD2_ASPCL Adenylate kinase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=adk1 PE=3 SV=1 149 326 4.0E-18
sp|P34346|KAD2_CAEEL Adenylate kinase OS=Caenorhabditis elegans GN=let-754 PE=3 SV=2 125 318 4.0E-18
sp|B0RB59|KAD_CLAMS Adenylate kinase OS=Clavibacter michiganensis subsp. sepedonicus (strain ATCC 33113 / DSM 20744 / JCM 9667 / LMG 2889 / C-1) GN=adk PE=3 SV=1 147 325 4.0E-18
sp|A6Q322|KAD_NITSB Adenylate kinase OS=Nitratiruptor sp. (strain SB155-2) GN=adk PE=3 SV=1 150 337 5.0E-18
sp|Q03IH2|KAD_STRTD Adenylate kinase OS=Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9) GN=adk PE=3 SV=1 149 333 5.0E-18
sp|Q6HPN7|KAD_BACHK Adenylate kinase OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=adk PE=3 SV=1 149 328 5.0E-18
sp|Q63H69|KAD_BACCZ Adenylate kinase OS=Bacillus cereus (strain ZK / E33L) GN=adk PE=3 SV=1 149 328 5.0E-18
sp|C1ET60|KAD_BACC3 Adenylate kinase OS=Bacillus cereus (strain 03BB102) GN=adk PE=3 SV=1 149 328 5.0E-18
sp|B7JKE1|KAD_BACC0 Adenylate kinase OS=Bacillus cereus (strain AH820) GN=adk PE=3 SV=1 149 328 5.0E-18
sp|Q81VQ9|KAD_BACAN Adenylate kinase OS=Bacillus anthracis GN=adk PE=3 SV=1 149 328 5.0E-18
sp|A0R8K1|KAD_BACAH Adenylate kinase OS=Bacillus thuringiensis (strain Al Hakam) GN=adk PE=3 SV=1 149 328 5.0E-18
sp|C3LJA3|KAD_BACAC Adenylate kinase OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=adk PE=3 SV=1 149 328 5.0E-18
sp|C3P9S6|KAD_BACAA Adenylate kinase OS=Bacillus anthracis (strain A0248) GN=adk PE=3 SV=1 149 328 5.0E-18
sp|O84130|KAD_CHLTR Adenylate kinase OS=Chlamydia trachomatis (strain D/UW-3/Cx) GN=adk PE=3 SV=1 149 326 5.0E-18
sp|Q3KMP1|KAD_CHLTA Adenylate kinase OS=Chlamydia trachomatis serovar A (strain ATCC VR-571B / DSM 19440 / HAR-13) GN=adk PE=3 SV=1 149 326 5.0E-18
sp|Q290A8|KAD2_DROPS Adenylate kinase OS=Drosophila pseudoobscura pseudoobscura GN=Adk2 PE=3 SV=2 150 330 5.0E-18
sp|Q822Z1|KAD_CHLCV Adenylate kinase OS=Chlamydophila caviae (strain GPIC) GN=adk PE=3 SV=1 150 326 5.0E-18
sp|Q81J22|KAD_BACCR Adenylate kinase OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=adk PE=3 SV=1 149 328 5.0E-18
sp|B7HJ69|KAD_BACC4 Adenylate kinase OS=Bacillus cereus (strain B4264) GN=adk PE=3 SV=1 149 328 5.0E-18
sp|Q5QWR3|KAD_IDILO Adenylate kinase OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=adk PE=3 SV=1 149 339 5.0E-18
sp|Q9Z8U0|KAD_CHLPN Adenylate kinase OS=Chlamydia pneumoniae GN=adk PE=3 SV=1 145 331 6.0E-18
sp|B0BBB5|KAD_CHLTB Adenylate kinase OS=Chlamydia trachomatis serovar L2b (strain UCH-1/proctitis) GN=adk PE=3 SV=1 149 326 6.0E-18
sp|B0B9N6|KAD_CHLT2 Adenylate kinase OS=Chlamydia trachomatis serovar L2 (strain 434/Bu / ATCC VR-902B) GN=adk PE=3 SV=1 149 326 6.0E-18
sp|Q6D7Z5|KAD_PECAS Adenylate kinase OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=adk PE=3 SV=1 149 333 6.0E-18
sp|P84139|KAD_SPOGL Adenylate kinase OS=Sporosarcina globispora GN=adk PE=1 SV=1 149 328 6.0E-18
sp|Q87RH4|KAD_VIBPA Adenylate kinase OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=adk PE=3 SV=1 149 333 6.0E-18
sp|Q47XA8|KAD_COLP3 Adenylate kinase OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=adk PE=3 SV=1 149 325 6.0E-18
sp|B0BQN2|KAD_ACTPJ Adenylate kinase OS=Actinobacillus pleuropneumoniae serotype 3 (strain JL03) GN=adk PE=3 SV=1 149 333 7.0E-18
sp|A3N1U8|KAD_ACTP2 Adenylate kinase OS=Actinobacillus pleuropneumoniae serotype 5b (strain L20) GN=adk PE=3 SV=1 149 333 7.0E-18
sp|Q6KI35|KAD_MYCMO Adenylate kinase OS=Mycoplasma mobile (strain ATCC 43663 / 163K / NCTC 11711) GN=adk PE=3 SV=1 149 333 7.0E-18
sp|Q0C7Y1|KAD2_ASPTN Adenylate kinase OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=adk1 PE=3 SV=1 149 326 7.0E-18
sp|A6ZYI0|KAD2_YEAS7 Adenylate kinase OS=Saccharomyces cerevisiae (strain YJM789) GN=ADK1 PE=3 SV=1 141 333 7.0E-18
sp|C4Z2V1|KAD_EUBE2 Adenylate kinase OS=Eubacterium eligens (strain ATCC 27750 / VPI C15-48) GN=adk PE=3 SV=1 149 333 7.0E-18
sp|Q3Z960|KAD_DEHM1 Adenylate kinase OS=Dehalococcoides mccartyi (strain ATCC BAA-2266 / KCTC 15142 / 195) GN=adk PE=3 SV=1 149 333 7.0E-18
sp|P07170|KAD2_YEAST Adenylate kinase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ADK1 PE=1 SV=2 149 333 8.0E-18
sp|B3LG61|KAD2_YEAS1 Adenylate kinase OS=Saccharomyces cerevisiae (strain RM11-1a) GN=ADK1 PE=3 SV=1 149 333 8.0E-18
sp|B3H271|KAD_ACTP7 Adenylate kinase OS=Actinobacillus pleuropneumoniae serotype 7 (strain AP76) GN=adk PE=3 SV=1 149 333 8.0E-18
sp|Q5L3R8|KAD_GEOKA Adenylate kinase OS=Geobacillus kaustophilus (strain HTA426) GN=adk PE=3 SV=1 149 333 9.0E-18
sp|B5XCA1|KAD2_SALSA Adenylate kinase 2, mitochondrial OS=Salmo salar GN=ak2 PE=2 SV=1 145 327 1.0E-17
sp|Q9HPA7|KAD_HALSA Adenylate kinase OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=adk PE=2 SV=1 149 336 1.0E-17
sp|B0R683|KAD_HALS3 Adenylate kinase OS=Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1) GN=adk PE=3 SV=1 149 336 1.0E-17
sp|Q6FM32|KAD2_CANGA Adenylate kinase OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=ADK1 PE=3 SV=1 149 333 1.0E-17
sp|Q250L1|KAD_DESHY Adenylate kinase OS=Desulfitobacterium hafniense (strain Y51) GN=adk PE=3 SV=1 150 321 1.0E-17
sp|B8G1Y7|KAD_DESHD Adenylate kinase OS=Desulfitobacterium hafniense (strain DCB-2 / DSM 10664) GN=adk PE=3 SV=1 150 321 1.0E-17
sp|C6DB87|KAD_PECCP Adenylate kinase OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=adk PE=3 SV=1 149 333 1.0E-17
sp|A0LIL1|KAD_SYNFM Adenylate kinase OS=Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB) GN=adk PE=3 SV=1 149 327 1.0E-17
sp|A1T4T2|KAD_MYCVP Adenylate kinase OS=Mycobacterium vanbaalenii (strain DSM 7251 / PYR-1) GN=adk PE=3 SV=1 149 333 1.0E-17
sp|Q38UT2|KAD_LACSS Adenylate kinase OS=Lactobacillus sakei subsp. sakei (strain 23K) GN=adk PE=3 SV=1 149 333 1.0E-17
sp|Q9PKR0|KAD_CHLMU Adenylate kinase OS=Chlamydia muridarum (strain MoPn / Nigg) GN=adk PE=3 SV=1 149 335 1.0E-17
sp|C0ZIK1|KAD_BREBN Adenylate kinase OS=Brevibacillus brevis (strain 47 / JCM 6285 / NBRC 100599) GN=adk PE=3 SV=1 149 334 1.0E-17
sp|Q5L5W0|KAD_CHLAB Adenylate kinase OS=Chlamydophila abortus (strain DSM 27085 / S26/3) GN=adk PE=3 SV=1 150 334 1.0E-17
sp|P0CO42|KAD2_CRYNJ Adenylate kinase OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=ADK1 PE=3 SV=1 135 336 1.0E-17
sp|P0CO43|KAD2_CRYNB Adenylate kinase OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=ADK1 PE=3 SV=1 135 336 1.0E-17
sp|B3NQ53|KAD2_DROER Adenylate kinase OS=Drosophila erecta GN=Adk2 PE=3 SV=1 150 327 1.0E-17
sp|P49981|KAD_NEIMU Adenylate kinase OS=Neisseria mucosa GN=adk PE=3 SV=1 149 328 1.0E-17
sp|B2G8V7|KAD_LACRJ Adenylate kinase OS=Lactobacillus reuteri (strain JCM 1112) GN=adk PE=3 SV=1 149 333 2.0E-17
sp|B3QS41|KAD_CHLT3 Adenylate kinase OS=Chloroherpeton thalassium (strain ATCC 35110 / GB-78) GN=adk PE=3 SV=1 149 333 2.0E-17
sp|C3LTN4|KAD_VIBCM Adenylate kinase OS=Vibrio cholerae serotype O1 (strain M66-2) GN=adk PE=3 SV=1 149 333 2.0E-17
sp|Q9KTB7|KAD_VIBCH Adenylate kinase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=adk PE=1 SV=1 149 333 2.0E-17
sp|A5F2U0|KAD_VIBC3 Adenylate kinase OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=adk PE=3 SV=1 149 333 2.0E-17
sp|A5FRW5|KAD_DEHMB Adenylate kinase OS=Dehalococcoides mccartyi (strain ATCC BAA-2100 / JCM 16839 / KCTC 5957 / BAV1) GN=adk PE=3 SV=1 149 333 2.0E-17
sp|Q9WTP7|KAD3_MOUSE GTP:AMP phosphotransferase AK3, mitochondrial OS=Mus musculus GN=Ak3 PE=1 SV=3 151 335 2.0E-17
sp|Q1QN09|KAD_NITHX Adenylate kinase OS=Nitrobacter hamburgensis (strain X14 / DSM 10229) GN=adk PE=3 SV=1 149 338 2.0E-17
sp|Q28F55|KAD2_XENTR Adenylate kinase 2, mitochondrial OS=Xenopus tropicalis GN=ak2 PE=2 SV=1 150 327 2.0E-17
sp|B2VHX2|KAD_ERWT9 Adenylate kinase OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=adk PE=3 SV=1 149 328 2.0E-17
sp|P29410|KAD2_RAT Adenylate kinase 2, mitochondrial OS=Rattus norvegicus GN=Ak2 PE=2 SV=2 151 327 2.0E-17
sp|B3WAJ7|KAD_LACCB Adenylate kinase OS=Lactobacillus casei (strain BL23) GN=adk PE=3 SV=1 149 333 2.0E-17
sp|A0QSH8|KAD_MYCS2 Adenylate kinase OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=adk PE=1 SV=1 149 307 3.0E-17
sp|A1SNJ7|KAD_NOCSJ Adenylate kinase OS=Nocardioides sp. (strain BAA-499 / JS614) GN=adk PE=3 SV=1 149 327 3.0E-17
sp|A7E8H8|KAD2_SCLS1 Adenylate kinase OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=adk1 PE=3 SV=1 135 326 3.0E-17
sp|B4KLY1|KAD2_DROMO Adenylate kinase OS=Drosophila mojavensis GN=Adk2 PE=3 SV=1 141 327 3.0E-17
sp|Q8UE38|KAD_AGRFC Adenylate kinase OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=adk PE=3 SV=1 149 336 3.0E-17
sp|E6MY99|KAD_NEIMH Adenylate kinase OS=Neisseria meningitidis serogroup B / serotype 15 (strain H44/76) GN=adk PE=3 SV=1 150 329 3.0E-17
sp|P0A0U7|KAD_NEIMB Adenylate kinase OS=Neisseria meningitidis serogroup B (strain MC58) GN=adk PE=3 SV=1 150 329 3.0E-17
sp|A7MT47|KAD_VIBCB Adenylate kinase OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=adk PE=3 SV=1 149 333 3.0E-17
sp|B2CNY4|KAD2_TALMA Adenylate kinase OS=Talaromyces marneffei GN=adk1 PE=1 SV=1 134 326 4.0E-17
sp|A6U880|KAD_SINMW Adenylate kinase OS=Sinorhizobium medicae (strain WSM419) GN=adk PE=3 SV=1 149 333 4.0E-17
sp|A2QPN9|KAD2_ASPNC Adenylate kinase OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=adk1 PE=3 SV=1 149 326 4.0E-17
sp|Q83G05|KAD_TROWT Adenylate kinase OS=Tropheryma whipplei (strain Twist) GN=adk PE=3 SV=1 150 326 4.0E-17
sp|Q83I60|KAD_TROW8 Adenylate kinase OS=Tropheryma whipplei (strain TW08/27) GN=adk PE=3 SV=1 150 326 4.0E-17
sp|A1KT73|KAD_NEIMF Adenylate kinase OS=Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18) GN=adk PE=3 SV=1 150 329 4.0E-17
sp|P0DH56|KAD_NEIME Adenylate kinase OS=Neisseria meningitidis GN=adk PE=3 SV=1 150 329 4.0E-17
sp|P0A0U6|KAD_NEIMA Adenylate kinase OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=adk PE=3 SV=1 150 329 4.0E-17
sp|A9M3Q2|KAD_NEIM0 Adenylate kinase OS=Neisseria meningitidis serogroup C (strain 053442) GN=adk PE=3 SV=1 150 329 4.0E-17
sp|B0RZT0|KAD_FINM2 Adenylate kinase OS=Finegoldia magna (strain ATCC 29328) GN=adk PE=3 SV=1 149 319 5.0E-17
sp|Q5B2V8|KAD2_EMENI Adenylate kinase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=adk1 PE=3 SV=1 149 326 5.0E-17
sp|B1JHN1|KAD_YERPY Adenylate kinase OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=adk PE=3 SV=1 149 328 6.0E-17
sp|Q66DP7|KAD_YERPS Adenylate kinase OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=adk PE=3 SV=1 149 328 6.0E-17
sp|A4TPA4|KAD_YERPP Adenylate kinase OS=Yersinia pestis (strain Pestoides F) GN=adk PE=3 SV=1 149 328 6.0E-17
sp|Q1CL27|KAD_YERPN Adenylate kinase OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=adk PE=3 SV=1 149 328 6.0E-17
sp|A9R0Q7|KAD_YERPG Adenylate kinase OS=Yersinia pestis bv. Antiqua (strain Angola) GN=adk PE=3 SV=1 149 328 6.0E-17
sp|O69172|KAD_YERPE Adenylate kinase OS=Yersinia pestis GN=adk PE=3 SV=1 149 328 6.0E-17
sp|B2K6Z6|KAD_YERPB Adenylate kinase OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=adk PE=3 SV=1 149 328 6.0E-17
sp|Q1C4P9|KAD_YERPA Adenylate kinase OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=adk PE=3 SV=1 149 328 6.0E-17
sp|A7FL86|KAD_YERP3 Adenylate kinase OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=adk PE=3 SV=1 149 328 6.0E-17
sp|C4L8U2|KAD_TOLAT Adenylate kinase OS=Tolumonas auensis (strain DSM 9187 / TA4) GN=adk PE=3 SV=1 149 338 6.0E-17
sp|Q4AAG0|KAD_MYCHJ Adenylate kinase OS=Mycoplasma hyopneumoniae (strain J / ATCC 25934 / NCTC 10110) GN=adk PE=3 SV=1 149 333 6.0E-17
sp|B2IK83|KAD_BEII9 Adenylate kinase OS=Beijerinckia indica subsp. indica (strain ATCC 9039 / DSM 1715 / NCIB 8712) GN=adk PE=3 SV=1 149 334 6.0E-17
sp|Q110C6|KAD_TRIEI Adenylate kinase OS=Trichodesmium erythraeum (strain IMS101) GN=adk PE=3 SV=1 148 325 6.0E-17
sp|A7ZEH4|KAD_CAMC1 Adenylate kinase OS=Campylobacter concisus (strain 13826) GN=adk PE=3 SV=1 150 333 6.0E-17
sp|Q2RFR8|KAD_MOOTA Adenylate kinase OS=Moorella thermoacetica (strain ATCC 39073) GN=adk PE=3 SV=1 149 325 6.0E-17
sp|Q4A8J1|KAD_MYCH7 Adenylate kinase OS=Mycoplasma hyopneumoniae (strain 7448) GN=adk PE=3 SV=1 149 333 7.0E-17
sp|O82514|KAD4_ARATH Adenylate kinase 4 OS=Arabidopsis thaliana GN=ADK1 PE=1 SV=2 143 333 7.0E-17
sp|B4QBH8|KAD2_DROSI Adenylate kinase OS=Drosophila simulans GN=Adk2 PE=3 SV=1 150 327 7.0E-17
sp|B4I2A8|KAD2_DROSE Adenylate kinase OS=Drosophila sechellia GN=Adk2-1 PE=3 SV=1 150 327 7.0E-17
sp|B4PAR6|KAD2_DROYA Adenylate kinase OS=Drosophila yakuba GN=Adk2 PE=3 SV=1 150 327 7.0E-17
sp|Q7QJX9|KAD2_ANOGA Adenylate kinase OS=Anopheles gambiae GN=Adk2 PE=3 SV=2 134 327 7.0E-17
sp|A0B9A2|KAD_METTP Adenylate kinase OS=Methanosaeta thermophila (strain DSM 6194 / JCM 14653 / NBRC 101360 / PT) GN=adk PE=3 SV=1 149 333 8.0E-17
sp|B9MKG1|KAD_CALBD Adenylate kinase OS=Caldicellulosiruptor bescii (strain ATCC BAA-1888 / DSM 6725 / Z-1320) GN=adk PE=3 SV=1 149 340 8.0E-17
sp|Q6LTE1|KAD_PHOPR Adenylate kinase OS=Photobacterium profundum GN=adk PE=1 SV=1 149 333 9.0E-17
sp|Q2K9J5|KAD_RHIEC Adenylate kinase OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=adk PE=3 SV=1 149 333 9.0E-17
sp|Q04BZ4|KAD_LACDB Adenylate kinase OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC BAA-365) GN=adk PE=3 SV=1 149 328 1.0E-16
sp|B2TIJ6|KAD_CLOBB Adenylate kinase OS=Clostridium botulinum (strain Eklund 17B / Type B) GN=adk PE=3 SV=1 149 336 1.0E-16
sp|Q9HE76|KAD2_NEUCR Adenylate kinase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=adk-1 PE=1 SV=2 149 326 1.0E-16
sp|Q9WTP6|KAD2_MOUSE Adenylate kinase 2, mitochondrial OS=Mus musculus GN=Ak2 PE=1 SV=5 145 327 1.0E-16
sp|P08166|KAD2_BOVIN Adenylate kinase 2, mitochondrial OS=Bos taurus GN=AK2 PE=1 SV=2 145 327 1.0E-16
sp|A1JNB1|KAD_YERE8 Adenylate kinase OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=adk PE=3 SV=1 149 328 1.0E-16
sp|Q2UBH0|KAD2_ASPOR Adenylate kinase OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=adk1 PE=3 SV=2 149 326 1.0E-16
sp|B4F1Q2|KAD_PROMH Adenylate kinase OS=Proteus mirabilis (strain HI4320) GN=adk PE=3 SV=1 149 338 1.0E-16
sp|Q3ZZQ3|KAD_DEHMC Adenylate kinase OS=Dehalococcoides mccartyi (strain CBDB1) GN=adk PE=3 SV=1 149 333 1.0E-16
sp|A9BWI1|KAD_DELAS Adenylate kinase OS=Delftia acidovorans (strain DSM 14801 / SPH-1) GN=adk PE=3 SV=1 149 307 1.0E-16
sp|B2UYD1|KAD_CLOBA Adenylate kinase OS=Clostridium botulinum (strain Alaska E43 / Type E3) GN=adk PE=3 SV=1 149 336 1.0E-16
sp|A8IAP0|KAD_AZOC5 Adenylate kinase OS=Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / NBRC 14845 / NCIMB 13405 / ORS 571) GN=adk PE=3 SV=1 149 325 1.0E-16
sp|Q1GBJ7|KAD_LACDA Adenylate kinase OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC 11842 / DSM 20081 / JCM 1002 / NBRC 13953 / NCIMB 11778) GN=adk PE=3 SV=1 149 328 1.0E-16
sp|Q3J7A3|KAD_NITOC Adenylate kinase OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=adk PE=3 SV=1 151 321 2.0E-16
sp|B4J672|KAD2_DROGR Adenylate kinase OS=Drosophila grimshawi GN=Adk2 PE=3 SV=1 150 327 2.0E-16
sp|B8ELE2|KAD_METSB Adenylate kinase OS=Methylocella silvestris (strain BL2 / DSM 15510 / NCIMB 13906) GN=adk PE=3 SV=1 148 333 2.0E-16
sp|B3MCQ5|KAD2_DROAN Adenylate kinase OS=Drosophila ananassae GN=Adk2 PE=3 SV=1 141 327 2.0E-16
sp|Q73NP0|KAD_TREDE Adenylate kinase OS=Treponema denticola (strain ATCC 35405 / CIP 103919 / DSM 14222) GN=adk PE=3 SV=1 152 327 2.0E-16
sp|A9KJH3|KAD_CLOPH Adenylate kinase OS=Clostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg) GN=adk PE=3 SV=1 149 328 2.0E-16
sp|B8HCY6|KAD_ARTCA Adenylate kinase OS=Arthrobacter chlorophenolicus (strain ATCC 700700 / DSM 12829 / JCM 12360 / NCIMB 13794 / A6) GN=adk PE=3 SV=1 147 318 2.0E-16
sp|Q47B46|KAD_DECAR Adenylate kinase OS=Dechloromonas aromatica (strain RCB) GN=adk PE=3 SV=1 149 309 2.0E-16
sp|Q9PQP0|KAD_UREPA Adenylate kinase OS=Ureaplasma parvum serovar 3 (strain ATCC 700970) GN=adk PE=3 SV=1 149 335 2.0E-16
sp|B1AIP0|KAD_UREP2 Adenylate kinase OS=Ureaplasma parvum serovar 3 (strain ATCC 27815 / 27 / NCTC 11736) GN=adk PE=3 SV=1 149 335 2.0E-16
sp|Q7MMR5|KAD_VIBVY Adenylate kinase OS=Vibrio vulnificus (strain YJ016) GN=adk PE=3 SV=1 149 333 2.0E-16
sp|B4UBC0|KAD_ANASK Adenylate kinase OS=Anaeromyxobacter sp. (strain K) GN=adk PE=3 SV=1 148 333 2.0E-16
sp|O33007|KAD_MYCLE Adenylate kinase OS=Mycobacterium leprae (strain TN) GN=adk PE=3 SV=2 149 327 2.0E-16
sp|B8ZS96|KAD_MYCLB Adenylate kinase OS=Mycobacterium leprae (strain Br4923) GN=adk PE=3 SV=1 149 327 2.0E-16
sp|A7GXF6|KAD_CAMC5 Adenylate kinase OS=Campylobacter curvus (strain 525.92) GN=adk PE=3 SV=1 150 334 3.0E-16
sp|Q9U915|KAD2_DROME Adenylate kinase OS=Drosophila melanogaster GN=Adk2 PE=1 SV=1 150 327 3.0E-16
sp|Q93FE6|KAD_RHIME Adenylate kinase OS=Rhizobium meliloti (strain 1021) GN=adk PE=3 SV=1 149 333 3.0E-16
sp|Q08480|KAD4_ORYSJ Adenylate kinase 4 OS=Oryza sativa subsp. japonica GN=ADK-B PE=2 SV=1 143 333 3.0E-16
sp|Q8DFM1|KAD_VIBVU Adenylate kinase OS=Vibrio vulnificus (strain CMCP6) GN=adk PE=3 SV=1 149 333 3.0E-16
sp|Q7M8A5|KAD_WOLSU Adenylate kinase OS=Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / LMG 7466 / NCTC 11488 / FDC 602W) GN=adk PE=3 SV=1 150 337 3.0E-16
sp|Q1L8L9|KAD2_DANRE Adenylate kinase 2, mitochondrial OS=Danio rerio GN=ak2 PE=2 SV=1 145 327 3.0E-16
sp|C1D6J0|KAD_LARHH Adenylate kinase OS=Laribacter hongkongensis (strain HLHK9) GN=adk PE=3 SV=1 149 307 3.0E-16
sp|Q3IKQ1|KAD_PSEHT Adenylate kinase OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=adk PE=3 SV=1 149 338 3.0E-16
sp|Q98Q02|KAD_MYCPU Adenylate kinase OS=Mycoplasma pulmonis (strain UAB CTIP) GN=adk PE=3 SV=1 150 333 3.0E-16
sp|B7VII5|KAD_VIBTL Adenylate kinase OS=Vibrio tasmaniensis (strain LGP32) GN=adk PE=3 SV=1 149 333 3.0E-16
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 27 0.45

Transmembrane Domains

Domain # Start End Length
1 85 107 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
SC16a Pure fungal culture 42.09 20.57 63.61
CcL In ants, during behavior modification 157.06 85.27 228.84
CcD In ants, recently dead 115.83 62.92 168.73

Differential expression

Label1 Label2 Q-value Significant difference
SC16a CcL 0.000286 yes
SC16a CcD 0.000286 yes
CcL CcD 0.194151 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|2288
MSHTARRQAVSIACTSFRSRPSPLVAVSVVARRLPLLPRRLLASSEGEKSSLSSSSSNPYSPNSSNNNKNHNNSY
KARGSHNQTTNIKILPFIAIIAIGSAAYVALVNRRKAMPPAIDADHQQQQQQQQQLPPPASTSPAFSPDKATVVF
VLGGPGAGKGTQCARLVAQYGFTHLSAGDLLRAEQDRPGSQFGDLIRSHIKDGLIVPMEVTVQLLENAMAEALNR
PGPRPARFLIDGFPRKLDQAYRFEAAVCNPSLVLFYDCPENVMKDRLLERGKTSGRADDNAESILKRFHTFVETS
MPVVDHYDKKGSVVKIDATHDPEAVYAETQKRLKEKLGDEF
Coding >Ophio5|2288
ATGTCCCACACGGCGCGGCGCCAGGCTGTTTCCATCGCATGCACAAGCTTCCGTTCTCGGCCGTCGCCGCTTGTC
GCCGTCTCCGTCGTCGCTCGTCGATTGCCTCTGCTGCCAAGACGACTCCTTGCTTCGTCGGAGGGAGAAAAAAGC
AGCCTCAGCAGCAGCAGCAGCAACCCCTATAGTCCCAATAGTAGCAACAACAACAAAAACCACAACAACAGCTAT
AAAGCCAGAGGCAGCCATAATCAGACTACTAACATCAAAATCTTGCCATTTATAGCCATCATCGCCATCGGTTCC
GCCGCCTACGTTGCTCTCGTCAACCGCCGCAAAGCAATGCCTCCAGCAATCGACGCTGACCACCAGCAGCAGCAG
CAGCAACAACAGCAGCTGCCCCCCCCAGCTTCCACCTCGCCCGCCTTCTCGCCCGATAAAGCAACCGTCGTCTTC
GTCCTCGGCGGCCCCGGCGCAGGCAAAGGAACTCAGTGCGCCCGTCTCGTGGCCCAGTACGGCTTCACCCATCTC
TCGGCCGGCGACCTGCTTCGCGCCGAGCAGGACCGTCCAGGCTCGCAATTCGGAGACCTGATCCGCTCCCACATC
AAGGACGGCCTCATCGTCCCCATGGAGGTCACCGTTCAGCTCCTCGAGAACGCCATGGCCGAAGCCCTCAACCGT
CCGGGTCCTCGACCCGCTCGCTTCCTCATCGACGGCTTCCCCCGCAAGCTCGATCAGGCCTATCGCTTCGAGGCC
GCCGTCTGCAACCCTAGCCTCGTCCTCTTCTACGATTGTCCCGAGAATGTCATGAAGGACCGCCTCTTGGAGCGT
GGCAAGACCAGCGGCAGGGCAGACGACAACGCCGAGAGCATCTTGAAGCGCTTCCACACCTTTGTCGAGACGAGC
ATGCCTGTCGTCGACCACTACGACAAGAAGGGCTCCGTCGTCAAGATCGACGCCACGCACGACCCGGAGGCCGTC
TATGCCGAAACCCAGAAGCGCCTTAAGGAAAAGCTCGGCGACGAATTC
Transcript >Ophio5|2288
ATGTCCCACACGGCGCGGCGCCAGGCTGTTTCCATCGCATGCACAAGCTTCCGTTCTCGGCCGTCGCCGCTTGTC
GCCGTCTCCGTCGTCGCTCGTCGATTGCCTCTGCTGCCAAGACGACTCCTTGCTTCGTCGGAGGGAGAAAAAAGC
AGCCTCAGCAGCAGCAGCAGCAACCCCTATAGTCCCAATAGTAGCAACAACAACAAAAACCACAACAACAGCTAT
AAAGCCAGAGGCAGCCATAATCAGACTACTAACATCAAAATCTTGCCATTTATAGCCATCATCGCCATCGGTTCC
GCCGCCTACGTTGCTCTCGTCAACCGCCGCAAAGCAATGCCTCCAGCAATCGACGCTGACCACCAGCAGCAGCAG
CAGCAACAACAGCAGCTGCCCCCCCCAGCTTCCACCTCGCCCGCCTTCTCGCCCGATAAAGCAACCGTCGTCTTC
GTCCTCGGCGGCCCCGGCGCAGGCAAAGGAACTCAGTGCGCCCGTCTCGTGGCCCAGTACGGCTTCACCCATCTC
TCGGCCGGCGACCTGCTTCGCGCCGAGCAGGACCGTCCAGGCTCGCAATTCGGAGACCTGATCCGCTCCCACATC
AAGGACGGCCTCATCGTCCCCATGGAGGTCACCGTTCAGCTCCTCGAGAACGCCATGGCCGAAGCCCTCAACCGT
CCGGGTCCTCGACCCGCTCGCTTCCTCATCGACGGCTTCCCCCGCAAGCTCGATCAGGCCTATCGCTTCGAGGCC
GCCGTCTGCAACCCTAGCCTCGTCCTCTTCTACGATTGTCCCGAGAATGTCATGAAGGACCGCCTCTTGGAGCGT
GGCAAGACCAGCGGCAGGGCAGACGACAACGCCGAGAGCATCTTGAAGCGCTTCCACACCTTTGTCGAGACGAGC
ATGCCTGTCGTCGACCACTACGACAAGAAGGGCTCCGTCGTCAAGATCGACGCCACGCACGACCCGGAGGCCGTC
TATGCCGAAACCCAGAAGCGCCTTAAGGAAAAGCTCGGCGACGAATTCTGA
Gene >Ophio5|2288
ATGTCCCACACGGCGCGGCGCCAGGCTGTTTCCATCGCATGCACAAGCTTCCGTTCTCGGCCGTCGCCGCTTGTC
GCCGTCTCCGTCGTCGCTCGTCGATTGCCTCTGCTGCCAAGACGACTCCTTGCTTCGTCGGAGGGAGAAAAAAGC
AGCCTCAGCAGCAGCAGCAGCAACCCCTATAGTCCCAATAGTAGCAACAACAACAAAAACCACAACAACAGCTAT
AAAGCCAGAGGCAGCCATAATCAGACTACTAACATCAAAATCTTGCCATTTATAGCCATCATCGCCATCGGTTCC
GCCGCCTACGTTGCTCTCGTCAACCGCCGCAAAGGTACAAAGGAAGCCAAACCACCCAATGGACAGAAACCTTTT
GTTAGGTAGCCACTGACACTCTCTTTCTTTACTTAGCAATGCCTCCAGCAATCGACGCTGACCACCAGCAGCAGC
AGCAGCAACAACAGCAGCTGCCCCCCCCAGCTTCCACCTCGCCCGCCTTCTCGCCCGATAAAGCAACCGTCGTCT
TCGTCCTCGGCGGCCCCGGCGCAGGCAAAGGAACTCAGTGCGCCCGTCTCGTGGCCCAGTACGGCTTCACCCATC
TCTCGGCCGGCGACCTGCTTCGCGCCGAGCAGGACCGTCCAGGCTCGCAATTCGGAGACCTGATCCGCTCCCACA
TCAAGGACGGCCTCATCGTCCCCATGGAGGTCACCGTTCAGCTCCTCGAGAACGCCATGGCCGAAGCCCTCAACC
GTCCGGGTCCTCGACCCGCTCGCTTCCTCATCGACGGCTTCCCCCGCAAGCTCGATCAGGCCTATCGCTTCGAGG
CCGCCGTCTGCAACCCTAGCCTCGTCCTCTTCTACGATTGTCCCGAGAATGTCATGAAGGACCGCCTCTTGGAGC
GTGGCAAGACCAGCGGCAGGGCAGACGACAACGCCGAGAGCATCTTGAAGCGCTTCCACACCTTTGTCGAGACGA
GCATGCCTGTCGTCGACCACTACGACAAGAAGGGCTCCGTCGTCAAGATCGACGCCACGCACGACCCGGAGGCCG
TCTATGCCGAAACCCAGAAGCGCCTTAAGGAAAAGCTCGGCGACGAATTCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail