Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|228
Gene name
Locationscaffold_1042:705..1585
Strand+
Gene length (bp)880
Transcript length (bp)762
Coding sequence length (bp)759
Protein length (aa) 253

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF10296 MMM1 Maintenance of mitochondrial morphology protein 1 1.3E-85 14 246

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|A4RM19|MMM1_MAGO7 Maintenance of mitochondrial morphology protein 1 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=MMM1 PE=3 SV=1 11 246 4.0E-125
sp|B2AVN3|MMM1_PODAN Maintenance of mitochondrial morphology protein 1 OS=Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) GN=MMM1 PE=3 SV=1 11 246 2.0E-119
sp|Q9P353|MMM1_NEUCR Maintenance of mitochondrial morphology protein 1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=mmm-1 PE=2 SV=1 11 246 1.0E-118
sp|A6RJQ7|MMM1_BOTFB Maintenance of mitochondrial morphology protein 1 OS=Botryotinia fuckeliana (strain B05.10) GN=mmm1 PE=3 SV=1 1 246 1.0E-114
sp|A7E559|MMM1_SCLS1 Maintenance of mitochondrial morphology protein 1 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=mmm1 PE=3 SV=1 6 246 4.0E-113
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|A4RM19|MMM1_MAGO7 Maintenance of mitochondrial morphology protein 1 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=MMM1 PE=3 SV=1 11 246 4.0E-125
sp|B2AVN3|MMM1_PODAN Maintenance of mitochondrial morphology protein 1 OS=Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) GN=MMM1 PE=3 SV=1 11 246 2.0E-119
sp|Q9P353|MMM1_NEUCR Maintenance of mitochondrial morphology protein 1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=mmm-1 PE=2 SV=1 11 246 1.0E-118
sp|A6RJQ7|MMM1_BOTFB Maintenance of mitochondrial morphology protein 1 OS=Botryotinia fuckeliana (strain B05.10) GN=mmm1 PE=3 SV=1 1 246 1.0E-114
sp|A7E559|MMM1_SCLS1 Maintenance of mitochondrial morphology protein 1 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=mmm1 PE=3 SV=1 6 246 4.0E-113
sp|B2VVB9|MMM1_PYRTR Maintenance of mitochondrial morphology protein 1 OS=Pyrenophora tritici-repentis (strain Pt-1C-BFP) GN=mmm1 PE=3 SV=1 8 246 1.0E-71
sp|Q0TYM0|MMM1_PHANO Maintenance of mitochondrial morphology protein 1 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=MMM1 PE=3 SV=1 8 246 5.0E-69
sp|Q4WDE0|MMM1_ASPFU Maintenance of mitochondrial morphology protein 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=mmm1 PE=3 SV=2 11 241 4.0E-58
sp|A1DLT0|MMM1_NEOFI Maintenance of mitochondrial morphology protein 1 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=mmm1 PE=3 SV=1 11 241 2.0E-57
sp|A1CM86|MMM1_ASPCL Maintenance of mitochondrial morphology protein 1 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=mmm1 PE=3 SV=1 11 241 2.0E-57
sp|Q1E432|MMM1_COCIM Maintenance of mitochondrial morphology protein 1 OS=Coccidioides immitis (strain RS) GN=MMM1 PE=3 SV=1 11 246 3.0E-57
sp|C5GLP2|MMM1_AJEDR Maintenance of mitochondrial morphology protein 1 OS=Ajellomyces dermatitidis (strain ER-3 / ATCC MYA-2586) GN=MMM1 PE=3 SV=1 11 241 7.0E-57
sp|C5JYV0|MMM1_AJEDS Maintenance of mitochondrial morphology protein 1 OS=Ajellomyces dermatitidis (strain SLH14081) GN=MMM1 PE=3 SV=1 11 241 9.0E-57
sp|B0YD09|MMM1_ASPFC Maintenance of mitochondrial morphology protein 1 OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=mmm1 PE=3 SV=2 11 241 2.0E-56
sp|B6QVB2|MMM1_TALMQ Maintenance of mitochondrial morphology protein 1 OS=Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333) GN=mmm1 PE=3 SV=1 11 241 7.0E-56
sp|C0NZU3|MMM1_AJECG Maintenance of mitochondrial morphology protein 1 OS=Ajellomyces capsulatus (strain G186AR / H82 / ATCC MYA-2454 / RMSCC 2432) GN=MMM1 PE=3 SV=1 11 241 8.0E-56
sp|Q0CH31|MMM1_ASPTN Maintenance of mitochondrial morphology protein 1 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=mmm1 PE=3 SV=2 5 241 1.0E-55
sp|C1GXJ4|MMM1_PARBA Maintenance of mitochondrial morphology protein 1 OS=Paracoccidioides lutzii (strain ATCC MYA-826 / Pb01) GN=MMM1 PE=3 SV=1 7 241 2.0E-55
sp|B8NDR8|MMM1_ASPFN Maintenance of mitochondrial morphology protein 1 OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=mmm1 PE=3 SV=1 11 241 2.0E-55
sp|C1GG16|MMM1_PARBD Maintenance of mitochondrial morphology protein 1 OS=Paracoccidioides brasiliensis (strain Pb18) GN=MMM1 PE=3 SV=2 7 241 2.0E-55
sp|A2R4N0|MMM1_ASPNC Maintenance of mitochondrial morphology protein 1 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=mmm1 PE=3 SV=1 11 246 3.0E-55
sp|C0SGL5|MMM1_PARBP Maintenance of mitochondrial morphology protein 1 OS=Paracoccidioides brasiliensis (strain Pb03) GN=MMM1 PE=3 SV=1 7 241 4.0E-55
sp|B8MTT8|MMM1_TALSN Maintenance of mitochondrial morphology protein 1 OS=Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006) GN=mmm1 PE=3 SV=1 11 241 4.0E-55
sp|Q2U9A7|MMM1_ASPOR Maintenance of mitochondrial morphology protein 1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=mmm1 PE=3 SV=1 9 241 1.0E-54
sp|Q5AQA2|MMM1_EMENI Maintenance of mitochondrial morphology protein 1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=mmm1 PE=3 SV=2 11 241 1.0E-54
sp|B6HDM7|MMM1_PENRW Maintenance of mitochondrial morphology protein 1 OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) GN=mmm1 PE=3 SV=1 11 241 2.0E-54
sp|Q6BH42|MMM1_DEBHA Maintenance of mitochondrial morphology protein 1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=MMM1 PE=3 SV=2 5 241 5.0E-54
sp|C5FRT9|MMM1_ARTOC Maintenance of mitochondrial morphology protein 1 OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=MMM1 PE=3 SV=1 8 246 7.0E-54
sp|C4JP24|MMM1_UNCRE Maintenance of mitochondrial morphology protein 1 OS=Uncinocarpus reesii (strain UAMH 1704) GN=MMM1 PE=3 SV=1 19 241 3.0E-53
sp|C4Y0Q6|MMM1_CLAL4 Maintenance of mitochondrial morphology protein 1 OS=Clavispora lusitaniae (strain ATCC 42720) GN=MMM1 PE=3 SV=1 6 246 3.0E-53
sp|C4YI11|MMM1_CANAW Maintenance of mitochondrial morphology protein 1 OS=Candida albicans (strain WO-1) GN=MMM1 PE=3 SV=1 12 246 1.0E-52
sp|Q59SI5|MMM1_CANAL Maintenance of mitochondrial morphology protein 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=MMM1 PE=3 SV=1 12 246 1.0E-52
sp|A3LSW7|MMM1_PICST Maintenance of mitochondrial morphology protein 1 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=MMM1 PE=3 SV=2 12 246 6.0E-52
sp|A5E3T2|MMM1_LODEL Maintenance of mitochondrial morphology protein 1 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=MMM1 PE=3 SV=1 12 246 4.0E-50
sp|C4R892|MMM1_PICPG Maintenance of mitochondrial morphology protein 1 OS=Komagataella pastoris (strain GS115 / ATCC 20864) GN=MMM1 PE=3 SV=1 12 246 9.0E-50
sp|Q6FVT7|MMM1_CANGA Maintenance of mitochondrial morphology protein 1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=MMM1 PE=3 SV=1 13 246 5.0E-49
sp|A5DGW8|MMM1_PICGU Maintenance of mitochondrial morphology protein 1 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=MMM1 PE=3 SV=2 12 246 4.0E-47
sp|Q6CJU9|MMM1_KLULA Maintenance of mitochondrial morphology protein 1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=MMM1 PE=3 SV=1 18 241 5.0E-47
sp|P41800|MMM1_YEAST Maintenance of mitochondrial morphology protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MMM1 PE=1 SV=2 12 241 8.0E-46
sp|A7A0Q0|MMM1_YEAS7 Maintenance of mitochondrial morphology protein 1 OS=Saccharomyces cerevisiae (strain YJM789) GN=MMM1 PE=3 SV=1 12 241 8.0E-46
sp|B5VMT6|MMM1_YEAS6 Maintenance of mitochondrial morphology protein 1 OS=Saccharomyces cerevisiae (strain AWRI1631) GN=MMM1 PE=3 SV=1 12 241 8.0E-46
sp|C5DCI0|MMM1_LACTC Maintenance of mitochondrial morphology protein 1 OS=Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284) GN=MMM1 PE=3 SV=1 12 241 7.0E-44
sp|A7TFL9|MMM1_VANPO Maintenance of mitochondrial morphology protein 1 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=MMM1 PE=3 SV=1 12 246 3.0E-43
sp|C5DRQ1|MMM1_ZYGRC Maintenance of mitochondrial morphology protein 1 OS=Zygosaccharomyces rouxii (strain ATCC 2623 / CBS 732 / NBRC 1130 / NCYC 568 / NRRL Y-229) GN=MMM1 PE=3 SV=1 12 246 1.0E-42
sp|C5M1Z6|MMM1_CANTT Maintenance of mitochondrial morphology protein 1 OS=Candida tropicalis (strain ATCC MYA-3404 / T1) GN=MMM1 PE=3 SV=1 12 246 3.0E-42
sp|Q75FA5|MMM1_ASHGO Maintenance of mitochondrial morphology protein 1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=MMM1 PE=3 SV=1 12 246 2.0E-41
sp|B9WFC9|MMM1_CANDC Maintenance of mitochondrial morphology protein 1 OS=Candida dubliniensis (strain CD36 / ATCC MYA-646 / CBS 7987 / NCPF 3949 / NRRL Y-17841) GN=MMM1 PE=3 SV=1 12 246 6.0E-41
sp|O74368|MMM1_SCHPO Maintenance of mitochondrial morphology protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mmm1 PE=3 SV=3 15 246 1.0E-35
sp|Q6CA06|MMM12_YARLI Maintenance of mitochondrial morphology protein 1-2 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=MMM1-2 PE=3 SV=1 98 246 1.0E-31
sp|Q6CAP9|MMM11_YARLI Maintenance of mitochondrial morphology protein 1-1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=MMM1-1 PE=3 SV=1 14 239 4.0E-31
sp|Q4P8B7|MMM1_USTMA Maintenance of mitochondrial morphology protein 1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=MMM1 PE=3 SV=2 4 244 4.0E-31
sp|B6K6N3|MMM1_SCHJY Maintenance of mitochondrial morphology protein 1 OS=Schizosaccharomyces japonicus (strain yFS275 / FY16936) GN=mmm1 PE=3 SV=2 15 246 5.0E-31
sp|P0CO80|MMM1_CRYNJ Maintenance of mitochondrial morphology protein 1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=MMM1 PE=3 SV=1 10 241 4.0E-23
sp|P0CO81|MMM1_CRYNB Maintenance of mitochondrial morphology protein 1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=MMM1 PE=3 SV=1 10 241 4.0E-23
sp|A8PRS6|MMM1_MALGO Maintenance of mitochondrial morphology protein 1 OS=Malassezia globosa (strain ATCC MYA-4612 / CBS 7966) GN=MMM1 PE=3 SV=2 13 234 2.0E-14
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 20 0.5

Transmembrane Domains

Domain # Start End Length
1 20 40 20

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|228
MTLFSFFPEFKSTFSFTQGLVVGQVSVVLILAAFIRFFIFGDPPSSDATASLKATERRARTLAHKQSLLSLRSTG
QRRNQILNRQKSSVLRSAPALTIGSILSKTYYNVDSHQPESLDWFNILVAQTIAQFRSDAQHDDAILDSLTKALN
GTSRPEFVDNIRVTELSLGDDFPIFSNCRIIPVDEDGLTVGDGIKFDAASAARDGTRLQARMDVDLSDMLTLAVE
TNLLLNYPKKFSAVLPQSVPVHARYDDL
Coding >Ophio5|228
ATGACTCTATTCAGCTTCTTCCCAGAATTCAAGTCAACATTCTCCTTTACGCAGGGGCTCGTGGTCGGGCAGGTC
TCTGTCGTACTGATATTGGCCGCTTTTATAAGATTCTTCATTTTCGGTGATCCGCCGTCTTCTGACGCCACTGCA
TCTTTAAAGGCAACGGAGCGGAGGGCTAGGACCTTGGCACACAAGCAGTCGCTCCTGAGCTTGCGCTCTACCGGC
CAGCGCCGTAACCAGATTCTAAATCGCCAGAAGTCGAGTGTTTTAAGAAGTGCGCCTGCTCTCACGATAGGATCA
ATCTTAAGCAAAACTTACTACAATGTCGATAGCCATCAGCCAGAAAGTTTGGATTGGTTCAACATCCTAGTCGCC
CAAACAATTGCCCAGTTTCGCAGTGACGCGCAACACGATGACGCTATACTCGACTCTCTGACGAAAGCATTGAAC
GGAACTTCACGGCCTGAATTCGTAGACAACATCCGGGTTACAGAATTAAGTCTGGGTGATGACTTTCCCATTTTC
AGCAACTGTCGAATCATCCCAGTCGATGAGGACGGGCTCACCGTGGGCGACGGTATCAAGTTCGACGCTGCGTCA
GCAGCCAGGGACGGGACACGGCTCCAAGCACGGATGGACGTGGACTTGAGCGACATGCTCACATTGGCTGTCGAG
ACGAATCTGCTTCTGAACTACCCCAAAAAGTTCTCCGCTGTCCTTCCGCAATCCGTCCCAGTCCACGCCCGCTAT
GATGATCTT
Transcript >Ophio5|228
ATGACTCTATTCAGCTTCTTCCCAGAATTCAAGTCAACATTCTCCTTTACGCAGGGGCTCGTGGTCGGGCAGGTC
TCTGTCGTACTGATATTGGCCGCTTTTATAAGATTCTTCATTTTCGGTGATCCGCCGTCTTCTGACGCCACTGCA
TCTTTAAAGGCAACGGAGCGGAGGGCTAGGACCTTGGCACACAAGCAGTCGCTCCTGAGCTTGCGCTCTACCGGC
CAGCGCCGTAACCAGATTCTAAATCGCCAGAAGTCGAGTGTTTTAAGAAGTGCGCCTGCTCTCACGATAGGATCA
ATCTTAAGCAAAACTTACTACAATGTCGATAGCCATCAGCCAGAAAGTTTGGATTGGTTCAACATCCTAGTCGCC
CAAACAATTGCCCAGTTTCGCAGTGACGCGCAACACGATGACGCTATACTCGACTCTCTGACGAAAGCATTGAAC
GGAACTTCACGGCCTGAATTCGTAGACAACATCCGGGTTACAGAATTAAGTCTGGGTGATGACTTTCCCATTTTC
AGCAACTGTCGAATCATCCCAGTCGATGAGGACGGGCTCACCGTGGGCGACGGTATCAAGTTCGACGCTGCGTCA
GCAGCCAGGGACGGGACACGGCTCCAAGCACGGATGGACGTGGACTTGAGCGACATGCTCACATTGGCTGTCGAG
ACGAATCTGCTTCTGAACTACCCCAAAAAGTTCTCCGCTGTCCTTCCGCAATCCGTCCCAGTCCACGCCCGCTAT
GATGATCTTTAA
Gene >Ophio5|228
ATGACTCTATTCAGCTTCTTCCCAGAATTCAAGTCAACGTGAGGCGTCTGGAATGCAATGCTCGGAGTGCAGCTA
ACGAGAACGCGGGATGCAGATTCTCCTTTACGCAGGGGCTCGTGGTCGGGCAGGTCTCTGTCGTACTGATATTGG
CCGCTTTTATAAGATTCTTCATTTTCGGTGATCCGCCGTCTTCTGACGCCACTGCATCTTTAAAGGCAACGGAGC
GGAGGGCTAGGACCTTGGCACACAAGCAGTCGCTCCTGAGCTTGCGCTCTACCGGCCAGCGCCGTAACCAGATTC
TAAATCGCCAGAAGTCGAGTGTTTTAAGAAGTGCGCCTGCTCTCACGATAGGATCAATCTTAAGCAAAACTTACT
ACAATGTCGATAGCCATCAGCCAGAAAGTTTGGATTGGTTCAACATCCTAGTCGCCCAAACAATTGCCCAGTTTC
GCAGTGACGCGCAACACGATGACGCTATACTCGACTCTCTGACGAAAGCATTGAACGGAACTTCACGGCCTGAAT
TCGTAGACAACATCCGGGTTACAGAATTAAGTCTGGGTGATGACTTTCCCATTTTCAGCAACTGTCGAATCATCC
CAGTCGATGAGGACGGGCTCACCGTGGGCGACGGTATCAAGTTCGACGCTGCGTCAGCAGCCAGGGACGGGACAC
GGCTCCAAGCACGGATGGACGTGGACTTGAGCGACATGCTCACATTGGCTGTCGAGACGAATCTGCTTCTGAACT
ACCCCAAAAAGTTCTCCGCTGTCCTTCCGGTGGCCTTATCCGTATCAGTAGTACGATTCAGTGGAACCTTGTCAA
TCTCCTTCATCCCAAGCAATCCGTCCCAGTCCACGCCCGCTATGATGATCTTTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail