Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|2276
Gene name
Locationscaffold_194:30467..31619
Strand+
Gene length (bp)1152
Transcript length (bp)1152
Coding sequence length (bp)1149
Protein length (aa) 383

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04261 Dyp_perox Dyp-type peroxidase family 8.4E-81 78 372

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P76536|YFEX_ECOLI Probable deferrochelatase/peroxidase YfeX OS=Escherichia coli (strain K12) GN=yfeX PE=1 SV=2 126 371 2.0E-39
sp|Q66BP4|EFEB_YERPS Deferrochelatase/peroxidase EfeB OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=efeB PE=3 SV=1 122 368 1.0E-09
sp|Q1CHD5|EFEB_YERPN Deferrochelatase/peroxidase EfeB OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=efeB PE=3 SV=1 122 368 3.0E-09
sp|Q7CI09|EFEB_YERPE Deferrochelatase/peroxidase EfeB OS=Yersinia pestis GN=efeB PE=3 SV=1 122 368 3.0E-09
sp|Q0TJ48|EFEB_ECOL5 Deferrochelatase/peroxidase EfeB OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=efeB PE=3 SV=1 122 368 1.0E-08
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P76536|YFEX_ECOLI Probable deferrochelatase/peroxidase YfeX OS=Escherichia coli (strain K12) GN=yfeX PE=1 SV=2 126 371 2.0E-39
sp|Q66BP4|EFEB_YERPS Deferrochelatase/peroxidase EfeB OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=efeB PE=3 SV=1 122 368 1.0E-09
sp|Q1CHD5|EFEB_YERPN Deferrochelatase/peroxidase EfeB OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=efeB PE=3 SV=1 122 368 3.0E-09
sp|Q7CI09|EFEB_YERPE Deferrochelatase/peroxidase EfeB OS=Yersinia pestis GN=efeB PE=3 SV=1 122 368 3.0E-09
sp|Q0TJ48|EFEB_ECOL5 Deferrochelatase/peroxidase EfeB OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=efeB PE=3 SV=1 122 368 1.0E-08
sp|A1A9S3|EFEB_ECOK1 Deferrochelatase/peroxidase EfeB OS=Escherichia coli O1:K1 / APEC GN=efeB PE=3 SV=1 122 371 2.0E-08
sp|Q8XAS4|EFEB_ECO57 Deferrochelatase/peroxidase EfeB OS=Escherichia coli O157:H7 GN=efeB PE=1 SV=1 122 368 2.0E-08
sp|Q1RDJ8|EFEB_ECOUT Deferrochelatase/peroxidase EfeB OS=Escherichia coli (strain UTI89 / UPEC) GN=efeB PE=3 SV=1 122 368 2.0E-08
sp|Q8CW71|EFEB_ECOL6 Deferrochelatase/peroxidase EfeB OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=efeB PE=2 SV=1 122 368 2.0E-08
sp|P31545|EFEB_ECOLI Deferrochelatase/peroxidase EfeB OS=Escherichia coli (strain K12) GN=efeB PE=1 SV=2 122 368 2.0E-08
sp|Q31Z86|EFEB_SHIBS Deferrochelatase/peroxidase EfeB OS=Shigella boydii serotype 4 (strain Sb227) GN=efeB PE=3 SV=1 122 368 2.0E-08
sp|Q3Z396|EFEB_SHISS Deferrochelatase/peroxidase EfeB OS=Shigella sonnei (strain Ss046) GN=efeB PE=3 SV=1 122 368 3.0E-08
sp|Q83LK4|EFEB_SHIFL Deferrochelatase/peroxidase EfeB OS=Shigella flexneri GN=efeB PE=3 SV=1 122 368 6.0E-08
sp|Q0T616|EFEB_SHIF8 Deferrochelatase/peroxidase EfeB OS=Shigella flexneri serotype 5b (strain 8401) GN=efeB PE=3 SV=1 122 368 6.0E-08
[Show less]

GO

GO Term Description Terminal node
GO:0004601 peroxidase activity Yes
GO:0020037 heme binding Yes
GO:0005488 binding No
GO:0097159 organic cyclic compound binding No
GO:0016491 oxidoreductase activity No
GO:0003824 catalytic activity No
GO:0016684 oxidoreductase activity, acting on peroxide as acceptor No
GO:0003674 molecular_function No
GO:0046906 tetrapyrrole binding No
GO:0016209 antioxidant activity No
GO:1901363 heterocyclic compound binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 26 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|2276
MEVPIRACNRALIIVFRPTPSATLARRYRLDPQHHRLLSRPLLRYPASGATRRTFSTRTAPAMSPPGAAPRAQAV
DGPLTQSAAFLVLSVLPGAEAAGTVRSALAGIEGLAKTVSFRDAGTSFSVTVGIGSEAWDRLTGGAARPAELHPF
RPVAGQTHTAVSTAGDVLVHIRSDRRDLCFEFERQLMKRLDGAVRVDDQTVGFRYFDQRDLLGFVDGTANPVGPA
RPASTLVTAAEDEAAVSGSYVVVQKYLHDMAAWDRLPAEKQEAIVGRTKMDNVELDDAAADEQKSHKTLATVEDD
QGVEHDILRDNMPFGAPGSGEFGTYFIGYSSRLWVMERMLDRMFIGDPPGKHDRILDYSKPVTGTVFFVPSAGFL
ANLDGGDD
Coding >Ophio5|2276
ATGGAGGTGCCGATCCGCGCGTGTAACAGAGCTCTTATTATTGTCTTCCGGCCAACTCCGAGTGCAACGCTGGCA
AGGCGCTATCGACTCGATCCGCAGCATCACCGTCTCCTCTCTCGGCCTCTCCTCCGATATCCCGCCTCCGGCGCC
ACCCGGCGCACTTTCTCTACTCGAACAGCGCCGGCTATGAGCCCCCCCGGCGCCGCTCCCCGCGCCCAGGCCGTC
GACGGCCCGCTTACGCAATCGGCCGCATTCCTGGTGCTGTCGGTGCTACCCGGAGCCGAAGCCGCCGGCACGGTC
CGGTCCGCTTTGGCCGGCATCGAGGGTCTGGCCAAGACGGTCAGCTTCCGCGACGCCGGCACCTCCTTCTCCGTC
ACCGTCGGCATTGGCAGCGAGGCCTGGGATCGGCTGACGGGCGGAGCGGCCCGGCCGGCGGAGCTACATCCATTC
CGGCCCGTTGCTGGCCAGACTCACACGGCGGTATCGACGGCCGGCGACGTACTTGTTCATATTCGTTCCGACCGG
CGCGACCTTTGCTTCGAGTTCGAGCGCCAGCTGATGAAGCGTCTTGACGGAGCCGTGCGAGTCGACGATCAGACC
GTCGGCTTCCGCTATTTCGATCAGCGCGATCTCCTCGGCTTTGTCGACGGCACTGCGAATCCCGTAGGTCCGGCC
CGACCGGCCTCGACCCTCGTCACGGCGGCTGAAGACGAGGCTGCGGTGTCCGGCAGCTACGTCGTCGTCCAGAAG
TATCTCCATGATATGGCTGCCTGGGACCGTCTCCCGGCCGAGAAGCAGGAAGCCATCGTTGGCCGCACCAAGATG
GACAATGTCGAGCTGGATGACGCGGCCGCCGACGAGCAGAAATCACACAAGACGCTGGCTACCGTCGAGGACGAT
CAAGGGGTCGAGCACGACATTCTTCGCGATAATATGCCCTTTGGCGCCCCCGGCTCCGGCGAGTTTGGCACCTAC
TTCATCGGTTACTCGAGCCGGCTCTGGGTCATGGAACGAATGCTGGACCGCATGTTCATTGGCGATCCTCCGGGG
AAGCACGACCGCATCCTCGACTATTCCAAGCCCGTCACCGGCACCGTCTTCTTCGTGCCCTCTGCTGGCTTTCTA
GCCAATCTTGATGGCGGCGACGAC
Transcript >Ophio5|2276
ATGGAGGTGCCGATCCGCGCGTGTAACAGAGCTCTTATTATTGTCTTCCGGCCAACTCCGAGTGCAACGCTGGCA
AGGCGCTATCGACTCGATCCGCAGCATCACCGTCTCCTCTCTCGGCCTCTCCTCCGATATCCCGCCTCCGGCGCC
ACCCGGCGCACTTTCTCTACTCGAACAGCGCCGGCTATGAGCCCCCCCGGCGCCGCTCCCCGCGCCCAGGCCGTC
GACGGCCCGCTTACGCAATCGGCCGCATTCCTGGTGCTGTCGGTGCTACCCGGAGCCGAAGCCGCCGGCACGGTC
CGGTCCGCTTTGGCCGGCATCGAGGGTCTGGCCAAGACGGTCAGCTTCCGCGACGCCGGCACCTCCTTCTCCGTC
ACCGTCGGCATTGGCAGCGAGGCCTGGGATCGGCTGACGGGCGGAGCGGCCCGGCCGGCGGAGCTACATCCATTC
CGGCCCGTTGCTGGCCAGACTCACACGGCGGTATCGACGGCCGGCGACGTACTTGTTCATATTCGTTCCGACCGG
CGCGACCTTTGCTTCGAGTTCGAGCGCCAGCTGATGAAGCGTCTTGACGGAGCCGTGCGAGTCGACGATCAGACC
GTCGGCTTCCGCTATTTCGATCAGCGCGATCTCCTCGGCTTTGTCGACGGCACTGCGAATCCCGTAGGTCCGGCC
CGACCGGCCTCGACCCTCGTCACGGCGGCTGAAGACGAGGCTGCGGTGTCCGGCAGCTACGTCGTCGTCCAGAAG
TATCTCCATGATATGGCTGCCTGGGACCGTCTCCCGGCCGAGAAGCAGGAAGCCATCGTTGGCCGCACCAAGATG
GACAATGTCGAGCTGGATGACGCGGCCGCCGACGAGCAGAAATCACACAAGACGCTGGCTACCGTCGAGGACGAT
CAAGGGGTCGAGCACGACATTCTTCGCGATAATATGCCCTTTGGCGCCCCCGGCTCCGGCGAGTTTGGCACCTAC
TTCATCGGTTACTCGAGCCGGCTCTGGGTCATGGAACGAATGCTGGACCGCATGTTCATTGGCGATCCTCCGGGG
AAGCACGACCGCATCCTCGACTATTCCAAGCCCGTCACCGGCACCGTCTTCTTCGTGCCCTCTGCTGGCTTTCTA
GCCAATCTTGATGGCGGCGACGACTGA
Gene >Ophio5|2276
ATGGAGGTGCCGATCCGCGCGTGTAACAGAGCTCTTATTATTGTCTTCCGGCCAACTCCGAGTGCAACGCTGGCA
AGGCGCTATCGACTCGATCCGCAGCATCACCGTCTCCTCTCTCGGCCTCTCCTCCGATATCCCGCCTCCGGCGCC
ACCCGGCGCACTTTCTCTACTCGAACAGCGCCGGCTATGAGCCCCCCCGGCGCCGCTCCCCGCGCCCAGGCCGTC
GACGGCCCGCTTACGCAATCGGCCGCATTCCTGGTGCTGTCGGTGCTACCCGGAGCCGAAGCCGCCGGCACGGTC
CGGTCCGCTTTGGCCGGCATCGAGGGTCTGGCCAAGACGGTCAGCTTCCGCGACGCCGGCACCTCCTTCTCCGTC
ACCGTCGGCATTGGCAGCGAGGCCTGGGATCGGCTGACGGGCGGAGCGGCCCGGCCGGCGGAGCTACATCCATTC
CGGCCCGTTGCTGGCCAGACTCACACGGCGGTATCGACGGCCGGCGACGTACTTGTTCATATTCGTTCCGACCGG
CGCGACCTTTGCTTCGAGTTCGAGCGCCAGCTGATGAAGCGTCTTGACGGAGCCGTGCGAGTCGACGATCAGACC
GTCGGCTTCCGCTATTTCGATCAGCGCGATCTCCTCGGCTTTGTCGACGGCACTGCGAATCCCGTAGGTCCGGCC
CGACCGGCCTCGACCCTCGTCACGGCGGCTGAAGACGAGGCTGCGGTGTCCGGCAGCTACGTCGTCGTCCAGAAG
TATCTCCATGATATGGCTGCCTGGGACCGTCTCCCGGCCGAGAAGCAGGAAGCCATCGTTGGCCGCACCAAGATG
GACAATGTCGAGCTGGATGACGCGGCCGCCGACGAGCAGAAATCACACAAGACGCTGGCTACCGTCGAGGACGAT
CAAGGGGTCGAGCACGACATTCTTCGCGATAATATGCCCTTTGGCGCCCCCGGCTCCGGCGAGTTTGGCACCTAC
TTCATCGGTTACTCGAGCCGGCTCTGGGTCATGGAACGAATGCTGGACCGCATGTTCATTGGCGATCCTCCGGGG
AAGCACGACCGCATCCTCGACTATTCCAAGCCCGTCACCGGCACCGTCTTCTTCGTGCCCTCTGCTGGCTTTCTA
GCCAATCTTGATGGCGGCGACGACTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail