Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|2268
Gene name
Locationscaffold_194:15210..17340
Strand+
Gene length (bp)2130
Transcript length (bp)1608
Coding sequence length (bp)1605
Protein length (aa) 535

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00067 p450 Cytochrome P450 5.5E-36 245 525

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q701P2|KO1_GIBIN Ent-kaurene oxidase OS=Gibberella intermedia GN=CYP503A1 PE=1 SV=1 30 533 1.0E-53
sp|O94142|KO1_GIBFU Ent-kaurene oxidase OS=Gibberella fujikuroi GN=CYP503A1 PE=1 SV=1 30 533 3.0E-53
sp|A1DA65|FTMG_NEOFI Fumitremorgin C monooxygenase OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=ftmP450-3 PE=3 SV=1 198 529 3.0E-36
sp|Q4WAX0|FTMG_ASPFU Fumitremorgin C monooxygenase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=ftmP450-3 PE=3 SV=1 198 506 2.0E-35
sp|B9WZX6|FTMG_ASPFM Fumitremorgin C monooxygenase OS=Neosartorya fumigata GN=ftmP450-3 PE=1 SV=1 198 529 4.0E-35
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q701P2|KO1_GIBIN Ent-kaurene oxidase OS=Gibberella intermedia GN=CYP503A1 PE=1 SV=1 30 533 1.0E-53
sp|O94142|KO1_GIBFU Ent-kaurene oxidase OS=Gibberella fujikuroi GN=CYP503A1 PE=1 SV=1 30 533 3.0E-53
sp|A1DA65|FTMG_NEOFI Fumitremorgin C monooxygenase OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=ftmP450-3 PE=3 SV=1 198 529 3.0E-36
sp|Q4WAX0|FTMG_ASPFU Fumitremorgin C monooxygenase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=ftmP450-3 PE=3 SV=1 198 506 2.0E-35
sp|B9WZX6|FTMG_ASPFM Fumitremorgin C monooxygenase OS=Neosartorya fumigata GN=ftmP450-3 PE=1 SV=1 198 529 4.0E-35
sp|Q9Y7C8|LOVA_ASPTE Dihydromonacolin L monooxygenase LovA OS=Aspergillus terreus GN=lovA PE=1 SV=1 198 498 4.0E-29
sp|P20815|CP3A5_HUMAN Cytochrome P450 3A5 OS=Homo sapiens GN=CYP3A5 PE=1 SV=1 278 496 2.0E-13
sp|P24463|CP3AC_CANLF Cytochrome P450 3A12 OS=Canis lupus familiaris GN=CYP3A12 PE=2 SV=1 273 496 5.0E-13
sp|P33268|CP3A8_MACFA Cytochrome P450 3A8 OS=Macaca fascicularis GN=CYP3A8 PE=1 SV=1 273 496 6.0E-13
sp|Q29478|CP2CV_CAPHE Cytochrome P450 2C31 (Fragment) OS=Capra hircus aegagrus GN=CYP2C31 PE=2 SV=1 250 499 7.0E-13
sp|Q8N118|CP4X1_HUMAN Cytochrome P450 4X1 OS=Homo sapiens GN=CYP4X1 PE=2 SV=1 282 500 1.0E-12
sp|Q964R1|CP6J1_BLAGE Cytochrome P450 6j1 OS=Blattella germanica GN=CYP6J1 PE=2 SV=1 247 500 2.0E-12
sp|Q9HB55|CP343_HUMAN Cytochrome P450 3A43 OS=Homo sapiens GN=CYP3A43 PE=1 SV=1 278 508 3.0E-12
sp|P00181|CP2C2_RABIT Cytochrome P450 2C2 OS=Oryctolagus cuniculus GN=CYP2C2 PE=1 SV=2 253 508 6.0E-12
sp|O55071|CP2BJ_MOUSE Cytochrome P450 2B19 OS=Mus musculus GN=Cyp2b19 PE=2 SV=1 213 510 6.0E-12
sp|O18993|CP3AL_CALJA Cytochrome P450 3A21 OS=Callithrix jacchus GN=CYP3A21 PE=2 SV=1 277 496 8.0E-12
sp|P24462|CP3A7_HUMAN Cytochrome P450 3A7 OS=Homo sapiens GN=CYP3A7 PE=1 SV=2 248 518 8.0E-12
sp|Q1ZXF5|C5084_DICDI Probable cytochrome P450 508A4 OS=Dictyostelium discoideum GN=cyp508A4 PE=3 SV=1 290 529 1.0E-11
sp|P08684|CP3A4_HUMAN Cytochrome P450 3A4 OS=Homo sapiens GN=CYP3A4 PE=1 SV=4 273 520 1.0E-11
sp|Q9V4I1|CP9B2_DROME Cytochrome P450 9b2 OS=Drosophila melanogaster GN=Cyp9b2 PE=2 SV=1 297 499 1.0E-11
sp|Q64406|CP3AF_CAVPO Cytochrome P450 3A15 OS=Cavia porcellus GN=CYP3A15 PE=2 SV=1 304 496 1.0E-11
sp|P11711|CP2A1_RAT Cytochrome P450 2A1 OS=Rattus norvegicus GN=Cyp2a1 PE=1 SV=2 262 517 1.0E-11
sp|P56656|CP239_MOUSE Cytochrome P450 2C39 OS=Mus musculus GN=Cyp2c39 PE=1 SV=2 250 499 2.0E-11
sp|Q9V4I0|CP9B1_DROME Cytochrome P450 9b1 OS=Drosophila melanogaster GN=Cyp9b1 PE=2 SV=1 297 499 2.0E-11
sp|P00178|CP2B4_RABIT Cytochrome P450 2B4 OS=Oryctolagus cuniculus GN=CYP2B4 PE=1 SV=1 250 500 3.0E-11
sp|Q86W10|CP4Z1_HUMAN Cytochrome P450 4Z1 OS=Homo sapiens GN=CYP4Z1 PE=2 SV=1 269 506 3.0E-11
sp|P12789|CP2B5_RABIT Cytochrome P450 2B5 OS=Oryctolagus cuniculus GN=CYP2B5 PE=2 SV=1 250 500 5.0E-11
sp|Q9VJ71|CP310_DROME Probable cytochrome P450 310a1 OS=Drosophila melanogaster GN=Cyp310a1 PE=2 SV=1 324 502 6.0E-11
sp|Q64148|CP3AA_MESAU Lithocholate 6-beta-hydroxylase OS=Mesocricetus auratus GN=CYP3A10 PE=1 SV=2 283 499 8.0E-11
sp|Q64581|CP3AI_RAT Cytochrome P450 3A18 OS=Rattus norvegicus GN=Cyp3a18 PE=2 SV=1 275 499 1.0E-10
sp|O48923|C71DA_SOYBN Cytochrome P450 71D10 OS=Glycine max GN=CYP71D10 PE=2 SV=1 287 503 1.0E-10
sp|P15149|CP2A2_RAT Cytochrome P450 2A2 OS=Rattus norvegicus GN=Cyp2a2 PE=1 SV=1 262 517 1.0E-10
sp|Q9JMA7|CP341_MOUSE Cytochrome P450 3A41 OS=Mus musculus GN=Cyp3a41a PE=1 SV=2 272 508 2.0E-10
sp|P14263|CP51_CANTR Lanosterol 14-alpha demethylase OS=Candida tropicalis GN=ERG11 PE=3 SV=2 219 473 2.0E-10
sp|O23051|KAO1_ARATH Ent-kaurenoic acid oxidase 1 OS=Arabidopsis thaliana GN=KAO1 PE=2 SV=1 283 503 2.0E-10
sp|Q9FIB0|C78A7_ARATH Cytochrome P450 78A7 OS=Arabidopsis thaliana GN=CYP78A7 PE=2 SV=1 269 481 2.0E-10
sp|Q64417|CP3AE_CAVPO Cytochrome P450 3A14 OS=Cavia porcellus GN=CYP3A14 PE=2 SV=2 297 496 3.0E-10
sp|Q64481|CP3AG_MOUSE Cytochrome P450 3A16 OS=Mus musculus GN=Cyp3a16 PE=2 SV=2 312 496 3.0E-10
sp|P19225|CP270_RAT Cytochrome P450 2C70 OS=Rattus norvegicus GN=Cyp2c70 PE=2 SV=1 270 499 3.0E-10
sp|Q64464|CP3AD_MOUSE Cytochrome P450 3A13 OS=Mus musculus GN=Cyp3a13 PE=1 SV=1 277 496 3.0E-10
sp|Q05556|CP2AB_RABIT Cytochrome P450 2A11 OS=Oryctolagus cuniculus GN=CYP2A11 PE=1 SV=1 262 513 3.0E-10
sp|P15123|CP2CG_RABIT Cytochrome P450 2C16 OS=Oryctolagus cuniculus GN=CYP2C16 PE=2 SV=1 229 499 6.0E-10
sp|Q96SQ9|CP2S1_HUMAN Cytochrome P450 2S1 OS=Homo sapiens GN=CYP2S1 PE=1 SV=2 254 494 6.0E-10
sp|Q64459|CP3AB_MOUSE Cytochrome P450 3A11 OS=Mus musculus GN=Cyp3a11 PE=1 SV=1 272 508 7.0E-10
sp|P10613|CP51_CANAL Lanosterol 14-alpha demethylase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ERG11 PE=3 SV=2 219 531 8.0E-10
sp|Q98T91|C340_ORYLA Cytochrome P450 3A40 OS=Oryzias latipes GN=cyp3a40 PE=2 SV=1 278 533 8.0E-10
sp|O09158|CP3AP_MOUSE Cytochrome P450 3A25 OS=Mus musculus GN=Cyp3a25 PE=1 SV=1 275 496 9.0E-10
sp|I7CT85|C7A53_PANGI Protopanaxadiol 6-hydroxylase OS=Panax ginseng PE=1 SV=1 268 498 1.0E-09
sp|Q8SPK0|CP4AP_PIG Cytochrome P450 4A25 OS=Sus scrofa GN=CYP4A25 PE=2 SV=1 249 500 1.0E-09
sp|Q8AXY5|C356_FUNHE Cytochrome P450 3A56 OS=Fundulus heteroclitus GN=cyp3a56 PE=2 SV=1 295 494 1.0E-09
sp|Q9UVC3|CP51_CUNEL Lanosterol 14-alpha demethylase OS=Cunninghamella elegans GN=CYP51 PE=3 SV=1 283 525 1.0E-09
sp|Q8SPK1|CP4AO_PIG Cytochrome P450 4A24 OS=Sus scrofa GN=CYP4A24 PE=2 SV=1 249 500 2.0E-09
sp|P10632|CP2C8_HUMAN Cytochrome P450 2C8 OS=Homo sapiens GN=CYP2C8 PE=1 SV=2 249 499 2.0E-09
sp|P05178|CP2C6_RAT Cytochrome P450 2C6 OS=Rattus norvegicus GN=Cyp2c6 PE=2 SV=2 254 499 2.0E-09
sp|Q9PVE8|C330_FUNHE Cytochrome P450 3A30 OS=Fundulus heteroclitus GN=cyp3a30 PE=2 SV=2 295 494 2.0E-09
sp|P08683|CP2CB_RAT Cytochrome P450 2C11 OS=Rattus norvegicus GN=Cyp2c11 PE=1 SV=1 250 499 2.0E-09
sp|Q54NY3|C554A_DICDI Probable cytochrome P450 554A1 OS=Dictyostelium discoideum GN=cyp554A1 PE=3 SV=1 246 511 2.0E-09
sp|Q9C5Y2|KAO2_ARATH Ent-kaurenoic acid oxidase 2 OS=Arabidopsis thaliana GN=KAO2 PE=2 SV=2 254 505 2.0E-09
sp|Q54QD2|C5171_DICDI Probable cytochrome P450 517A1 OS=Dictyostelium discoideum GN=cyp517A1 PE=2 SV=1 253 503 2.0E-09
sp|P48420|C78A1_MAIZE Cytochrome P450 78A1 OS=Zea mays GN=CYP78A1 PE=2 SV=1 271 503 2.0E-09
sp|P11707|CP3A6_RABIT Cytochrome P450 3A6 OS=Oryctolagus cuniculus GN=CYP3A6 PE=2 SV=2 251 501 2.0E-09
sp|Q9V5L3|C49A1_DROME Probable cytochrome P450 49a1 OS=Drosophila melanogaster GN=Cyp49a1 PE=2 SV=3 321 490 2.0E-09
sp|P20812|CP2A3_RAT Cytochrome P450 2A3 OS=Rattus norvegicus GN=Cyp2a3 PE=2 SV=1 262 496 3.0E-09
sp|P79102|CP3AS_BOVIN Cytochrome P450 3A28 OS=Bos taurus GN=CYP3A28 PE=2 SV=1 269 496 3.0E-09
sp|P15392|CP2A4_MOUSE Cytochrome P450 2A4 OS=Mus musculus GN=Cyp2a4 PE=2 SV=3 205 496 3.0E-09
sp|Q54QD0|C5174_DICDI Probable cytochrome P450 517A4 OS=Dictyostelium discoideum GN=cyp517A4 PE=3 SV=1 253 503 3.0E-09
sp|P79401|CP3AT_PIG Cytochrome P450 3A29 OS=Sus scrofa GN=CYP3A29 PE=2 SV=1 269 496 3.0E-09
sp|B5BSX1|BAMO_GLYUR Beta-amyrin 11-oxidase OS=Glycyrrhiza uralensis GN=CYP88D6 PE=1 SV=1 296 503 4.0E-09
sp|P00179|CP2C5_RABIT Cytochrome P450 2C5 OS=Oryctolagus cuniculus GN=CYP2C5 PE=1 SV=2 250 499 4.0E-09
sp|Q92104|CP11B_LITCT Cytochrome P450 11B, mitochondrial OS=Lithobates catesbeiana GN=CYP11B PE=2 SV=1 322 520 4.0E-09
sp|Q9GJX5|CP4AL_PIG Taurochenodeoxycholic 6 alpha-hydroxylase OS=Sus scrofa GN=CYP4A21 PE=1 SV=1 297 500 4.0E-09
sp|Q64458|CP2CT_MOUSE Cytochrome P450 2C29 OS=Mus musculus GN=Cyp2c29 PE=1 SV=2 250 499 4.0E-09
sp|P11371|CP2C4_RABIT Cytochrome P450 2C4 OS=Oryctolagus cuniculus GN=CYP2C4 PE=2 SV=1 250 499 5.0E-09
sp|Q9VMT5|C28D1_DROME Probable cytochrome P450 28d1 OS=Drosophila melanogaster GN=Cyp28d1 PE=2 SV=1 283 527 5.0E-09
sp|O65787|C71B6_ARATH Cytochrome P450 71B6 OS=Arabidopsis thaliana GN=CYP71B6 PE=2 SV=1 212 498 6.0E-09
sp|P79152|CP3AJ_CAPHE Cytochrome P450 3A19 (Fragment) OS=Capra hircus aegagrus GN=CYP3A19 PE=2 SV=1 326 496 6.0E-09
sp|Q91W64|CP270_MOUSE Cytochrome P450 2C70 OS=Mus musculus GN=Cyp2c70 PE=1 SV=2 270 499 6.0E-09
sp|O35728|CP4AE_MOUSE Cytochrome P450 4A14 OS=Mus musculus GN=Cyp4a14 PE=1 SV=1 269 499 6.0E-09
sp|Q64409|CP3AH_CAVPO Cytochrome P450 3A17 OS=Cavia porcellus GN=CYP3A17 PE=2 SV=1 304 496 6.0E-09
sp|Q9VVR9|C12C1_DROME Probable cytochrome P450 12c1, mitochondrial OS=Drosophila melanogaster GN=Cyp12c1 PE=2 SV=2 321 513 7.0E-09
sp|Q92088|CP2M1_ONCMY Cytochrome P450 2M1 OS=Oncorhynchus mykiss GN=cyp2m1 PE=1 SV=1 209 510 8.0E-09
sp|D5JBX1|GAO_BARSP Germacrene A oxidase OS=Barnadesia spinosa PE=1 SV=1 212 494 9.0E-09
sp|P24464|CP4AC_RAT Cytochrome P450 4A12 OS=Rattus norvegicus GN=Cyp4a12 PE=2 SV=2 297 499 9.0E-09
sp|Q16696|CP2AD_HUMAN Cytochrome P450 2A13 OS=Homo sapiens GN=CYP2A13 PE=1 SV=3 262 513 1.0E-08
sp|O18635|C12A2_MUSDO Cytochrome P450 CYP12A2 OS=Musca domestica GN=CYP12A2 PE=2 SV=1 321 496 1.0E-08
sp|Q29496|CP3AO_SHEEP Cytochrome P450 3A24 OS=Ovis aries GN=CYP3A24 PE=2 SV=1 278 496 1.0E-08
sp|P33261|CP2CJ_HUMAN Cytochrome P450 2C19 OS=Homo sapiens GN=CYP2C19 PE=1 SV=3 260 499 1.0E-08
sp|P37121|C76A1_SOLME Cytochrome P450 76A1 (Fragment) OS=Solanum melongena GN=CYP76A1 PE=2 SV=1 243 478 1.0E-08
sp|P10611|CP4A4_RABIT Cytochrome P450 4A4 OS=Oryctolagus cuniculus GN=CYP4A4 PE=1 SV=3 297 499 1.0E-08
sp|P00182|CP2C3_RABIT Cytochrome P450 2C3 OS=Oryctolagus cuniculus GN=CYP2C3 PE=1 SV=2 278 499 1.0E-08
sp|O70537|CP3AV_MESAU Cytochrome P450 3A31 OS=Mesocricetus auratus GN=CYP3A31 PE=2 SV=1 5 499 2.0E-08
sp|Q9VMT6|C28D2_DROME Probable cytochrome P450 28d2 OS=Drosophila melanogaster GN=Cyp28d2 PE=3 SV=1 269 527 2.0E-08
sp|Q1ZXH9|CP51_DICDI Probable lanosterol 14-alpha demethylase OS=Dictyostelium discoideum GN=cyp51 PE=3 SV=1 254 479 2.0E-08
sp|P13527|CP6A1_MUSDO Cytochrome P450 6A1 OS=Musca domestica GN=CYP6A1 PE=2 SV=1 244 445 3.0E-08
sp|O65786|C71B4_ARATH Cytochrome P450 71B4 OS=Arabidopsis thaliana GN=CYP71B4 PE=2 SV=2 235 494 3.0E-08
sp|P51589|CP2J2_HUMAN Cytochrome P450 2J2 OS=Homo sapiens GN=CYP2J2 PE=1 SV=2 214 510 3.0E-08
sp|Q6A152|CP4X1_MOUSE Cytochrome P450 4X1 OS=Mus musculus GN=Cyp4x1 PE=1 SV=1 299 500 3.0E-08
sp|P24461|CP2G1_RABIT Cytochrome P450 2G1 OS=Oryctolagus cuniculus GN=CYP2G1 PE=1 SV=1 230 499 4.0E-08
sp|P14580|CP4A6_RABIT Cytochrome P450 4A6 OS=Oryctolagus cuniculus GN=CYP4A6 PE=1 SV=1 297 531 5.0E-08
sp|P22680|CP7A1_HUMAN Cholesterol 7-alpha-monooxygenase OS=Homo sapiens GN=CYP7A1 PE=1 SV=2 198 501 5.0E-08
sp|Q9FH76|ABAH3_ARATH Abscisic acid 8'-hydroxylase 3 OS=Arabidopsis thaliana GN=CYP707A3 PE=1 SV=1 279 529 5.0E-08
sp|P49264|C71B1_THLAR Cytochrome P450 71B1 OS=Thlaspi arvense GN=CYP71B1 PE=2 SV=1 297 503 6.0E-08
sp|O64989|C90B1_ARATH Cytochrome P450 90B1 OS=Arabidopsis thaliana GN=CYP90B1 PE=1 SV=2 282 503 6.0E-08
sp|P58051|C71BE_ARATH Cytochrome P450 71B14 OS=Arabidopsis thaliana GN=CYP71B14 PE=2 SV=1 310 494 6.0E-08
sp|P93846|CP51_SORBI Obtusifoliol 14-alpha demethylase OS=Sorghum bicolor GN=CYP51 PE=1 SV=1 17 510 7.0E-08
sp|P93596|CP51_WHEAT Obtusifoliol 14-alpha demethylase (Fragment) OS=Triticum aestivum GN=CYP51 PE=2 SV=1 219 510 7.0E-08
sp|Q91WL5|CP4CA_MOUSE Cytochrome P450 4A12A OS=Mus musculus GN=Cyp4a12a PE=1 SV=2 297 499 7.0E-08
sp|Q9GQM9|CP6L1_BLAGE Cytochrome P450 6l1 OS=Blattella germanica GN=CYP6L1 PE=2 SV=1 278 512 8.0E-08
sp|Q9VE00|C12A4_DROME Probable cytochrome P450 12a4, mitochondrial OS=Drosophila melanogaster GN=Cyp12a4 PE=2 SV=2 321 496 8.0E-08
sp|O22307|C71DB_LOTJA Cytochrome P450 71D11 (Fragment) OS=Lotus japonicus GN=CYP71D11 PE=2 SV=1 296 501 9.0E-08
sp|P33260|CP2CI_HUMAN Cytochrome P450 2C18 OS=Homo sapiens GN=CYP2C18 PE=1 SV=3 250 499 9.0E-08
sp|P56593|CP2AC_MOUSE Cytochrome P450 2A12 OS=Mus musculus GN=Cyp2a12 PE=1 SV=2 262 496 1.0E-07
sp|P51538|CP3A9_RAT Cytochrome P450 3A9 OS=Rattus norvegicus GN=Cyp3a9 PE=2 SV=2 278 508 1.0E-07
sp|P11712|CP2C9_HUMAN Cytochrome P450 2C9 OS=Homo sapiens GN=CYP2C9 PE=1 SV=3 261 499 1.0E-07
sp|O42563|CP3AR_ONCMY Cytochrome P450 3A27 OS=Oncorhynchus mykiss GN=cyp3a27 PE=2 SV=1 306 494 1.0E-07
sp|P04800|CP3A1_RAT Cytochrome P450 3A1 OS=Rattus norvegicus GN=Cyp3a1 PE=1 SV=1 272 508 1.0E-07
sp|P11372|CP2CF_RABIT Cytochrome P450 2C15 (Fragment) OS=Oryctolagus cuniculus GN=CYP2C15 PE=2 SV=1 194 499 1.0E-07
sp|O64638|C76C3_ARATH Cytochrome P450 76C3 OS=Arabidopsis thaliana GN=CYP76C3 PE=2 SV=2 270 524 1.0E-07
sp|Q6XQ14|C71E7_MANES 2-methylbutanal oxime monooxygenase OS=Manihot esculenta GN=CYP71E7 PE=1 SV=1 289 501 2.0E-07
sp|Q9LZ31|C77A4_ARATH Cytochrome P450 77A4 OS=Arabidopsis thaliana GN=CYP77A4 PE=2 SV=1 278 498 2.0E-07
sp|Q29510|CP2CU_RABIT Cytochrome P450 2C30 OS=Oryctolagus cuniculus GN=CYP2C30 PE=2 SV=1 194 499 2.0E-07
sp|Q54CS3|C508C_DICDI Probable cytochrome P450 508C1 OS=Dictyostelium discoideum GN=cyp508C1 PE=3 SV=1 246 528 2.0E-07
sp|P98183|C71DC_CATRO Tabersonine 16-hydroxylase (Fragment) OS=Catharanthus roseus GN=CYP71D12 PE=1 SV=1 213 498 2.0E-07
sp|P20816|CP4A2_RAT Cytochrome P450 4A2 OS=Rattus norvegicus GN=Cyp4a2 PE=1 SV=2 269 499 3.0E-07
sp|P15129|CP4B1_RAT Cytochrome P450 4B1 OS=Rattus norvegicus GN=Cyp4b1 PE=1 SV=3 269 502 3.0E-07
sp|Q1ZXF3|C5172_DICDI Probable cytochrome P450 517A2 OS=Dictyostelium discoideum GN=cyp517A2 PE=3 SV=1 270 519 3.0E-07
sp|Q63688|CP7B1_RAT 25-hydroxycholesterol 7-alpha-hydroxylase (Fragment) OS=Rattus norvegicus GN=Cyp7b1 PE=1 SV=1 199 506 3.0E-07
sp|Q92045|CP11A_DASAM Cholesterol side-chain cleavage enzyme, mitochondrial (Fragment) OS=Dasyatis americana GN=CYP11A1 PE=2 SV=1 317 502 3.0E-07
sp|P58048|C71B8_ARATH Cytochrome P450 71B8 OS=Arabidopsis thaliana GN=CYP71B8 PE=3 SV=1 267 503 3.0E-07
sp|O48927|C78A3_SOYBN Cytochrome P450 78A3 OS=Glycine max GN=CYP78A3 PE=2 SV=1 269 498 3.0E-07
sp|P05181|CP2E1_HUMAN Cytochrome P450 2E1 OS=Homo sapiens GN=CYP2E1 PE=1 SV=1 254 514 3.0E-07
sp|Q9LHA1|C8D11_ARATH Cytochrome P450 81D11 OS=Arabidopsis thaliana GN=CYP81D11 PE=2 SV=1 264 494 3.0E-07
sp|Q5UQI3|CP51_MIMIV Probable lanosterol 14-alpha demethylase OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L808 PE=3 SV=1 42 498 3.0E-07
sp|E1B2Z9|C7AV8_CICIN Cytochrome P450 71AV8 OS=Cichorium intybus GN=CYP71AV8 PE=2 SV=1 212 494 4.0E-07
sp|Q6R7M4|C15A1_DIPPU Methyl farnesoate epoxidase OS=Diploptera punctata GN=CYP15A1 PE=1 SV=1 264 508 4.0E-07
sp|P13584|CP4B1_HUMAN Cytochrome P450 4B1 OS=Homo sapiens GN=CYP4B1 PE=1 SV=2 269 502 5.0E-07
sp|B9X287|C7346_ORYSJ Cytochrome P450 734A6 OS=Oryza sativa subsp. japonica GN=CYP734A6 PE=2 SV=1 264 501 5.0E-07
sp|Q8K4D6|CP4X1_RAT Cytochrome P450 4X1 OS=Rattus norvegicus GN=Cyp4x1 PE=2 SV=1 242 502 5.0E-07
sp|P20817|CP4AE_RAT Cytochrome P450 4A14 OS=Rattus norvegicus GN=Cyp4a14 PE=1 SV=2 269 499 5.0E-07
sp|Q964T2|CP9E2_BLAGE Cytochrome P450 9e2 OS=Blattella germanica GN=CYP9E2 PE=2 SV=1 313 527 6.0E-07
sp|P20678|CP2H2_CHICK Cytochrome P450 2H2 OS=Gallus gallus GN=CYP2H2 PE=1 SV=1 214 499 7.0E-07
sp|Q9V773|C6A20_DROME Probable cytochrome P450 6a20 OS=Drosophila melanogaster GN=Cyp6a20 PE=2 SV=2 257 504 7.0E-07
sp|Q9LTL2|C71BP_ARATH Cytochrome P450 71B25 OS=Arabidopsis thaliana GN=CYP71B25 PE=2 SV=1 298 494 7.0E-07
sp|O75881|CP7B1_HUMAN 25-hydroxycholesterol 7-alpha-hydroxylase OS=Homo sapiens GN=CYP7B1 PE=1 SV=2 121 512 1.0E-06
sp|Q6GUQ4|CP2E1_MACMU Cytochrome P450 2E1 OS=Macaca mulatta GN=CYP2E1 PE=2 SV=1 254 514 1.0E-06
sp|D5JBW9|GAO_SAUCO Germacrene A oxidase OS=Saussurea costus PE=1 SV=1 212 503 1.0E-06
sp|P14579|CP4A5_RABIT Cytochrome P450 4A5 OS=Oryctolagus cuniculus GN=CYP4A5 PE=2 SV=1 297 499 1.0E-06
sp|Q9ZU07|C71BC_ARATH Cytochrome P450 71B12 OS=Arabidopsis thaliana GN=CYP71B12 PE=2 SV=1 310 494 1.0E-06
sp|D5JBW8|GAO_CICIN Germacrene A oxidase OS=Cichorium intybus PE=1 SV=1 212 503 1.0E-06
sp|P12791|CP2BA_MOUSE Cytochrome P450 2B10 OS=Mus musculus GN=Cyp2b10 PE=1 SV=1 213 515 1.0E-06
sp|Q69XM6|C7344_ORYSJ Cytochrome P450 734A4 OS=Oryza sativa subsp. japonica GN=CYP734A4 PE=2 SV=1 282 501 1.0E-06
sp|P05183|CP3A2_RAT Cytochrome P450 3A2 OS=Rattus norvegicus GN=Cyp3a2 PE=1 SV=2 285 508 1.0E-06
sp|Q9LTL0|C71BQ_ARATH Cytochrome P450 71B26 OS=Arabidopsis thaliana GN=CYP71B26 PE=2 SV=1 318 498 1.0E-06
sp|P08516|CP4AA_RAT Cytochrome P450 4A10 OS=Rattus norvegicus GN=Cyp4a10 PE=1 SV=2 269 499 2.0E-06
sp|Q9V9L1|CP6W1_DROME Probable cytochrome P450 6w1 OS=Drosophila melanogaster GN=Cyp6w1 PE=2 SV=1 269 496 2.0E-06
sp|Q9VGB5|CP135_DROME Probable cytochrome P450 313a5 OS=Drosophila melanogaster GN=Cyp313a5 PE=1 SV=2 284 417 2.0E-06
sp|P56591|CP1A1_SHEEP Cytochrome P450 1A1 OS=Ovis aries GN=CYP1A1 PE=2 SV=1 271 499 2.0E-06
sp|Q12609|STCF_EMENI Probable sterigmatocystin biosynthesis P450 monooxygenase stcF OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=stcF PE=3 SV=3 281 502 2.0E-06
sp|P24470|CP2CN_RAT Cytochrome P450 2C23 OS=Rattus norvegicus GN=Cyp2c23 PE=2 SV=2 254 499 2.0E-06
sp|P33265|CP2CS_MESAU Cytochrome P450 2C28 OS=Mesocricetus auratus GN=CYP2C28 PE=2 SV=1 250 499 2.0E-06
sp|Q64462|CP4B1_MOUSE Cytochrome P450 4B1 OS=Mus musculus GN=Cyp4b1 PE=1 SV=1 297 511 2.0E-06
sp|O64636|C76C1_ARATH Cytochrome P450 76C1 OS=Arabidopsis thaliana GN=CYP76C1 PE=2 SV=1 270 498 2.0E-06
sp|P47195|C80A1_BERST Berbamunine synthase OS=Berberis stolonifera GN=CYP80A1 PE=1 SV=1 254 494 3.0E-06
sp|Q556M4|C5082_DICDI Probable cytochrome P450 508A2 OS=Dictyostelium discoideum GN=cyp508A2-1 PE=3 SV=1 296 520 3.0E-06
sp|Q5IZM4|CP51_MYCVP Lanosterol 14-alpha demethylase OS=Mycobacterium vanbaalenii (strain DSM 7251 / PYR-1) GN=cyp51 PE=3 SV=1 296 501 3.0E-06
sp|O54750|CP2J6_MOUSE Cytochrome P450 2J6 OS=Mus musculus GN=Cyp2j6 PE=2 SV=2 214 494 3.0E-06
sp|Q64505|CP7A1_MOUSE Cholesterol 7-alpha-monooxygenase OS=Mus musculus GN=Cyp7a1 PE=2 SV=2 194 501 3.0E-06
sp|P10612|CP11A_PIG Cholesterol side-chain cleavage enzyme, mitochondrial OS=Sus scrofa GN=CYP11A1 PE=1 SV=1 317 520 3.0E-06
sp|Q9SAA9|CP511_ARATH Sterol 14-demethylase OS=Arabidopsis thaliana GN=CYP51G1 PE=1 SV=1 212 501 3.0E-06
sp|O77809|CP1A2_MACFA Cytochrome P450 1A2 OS=Macaca fascicularis GN=CYP1A2 PE=1 SV=3 273 501 3.0E-06
sp|P58050|C71BD_ARATH Cytochrome P450 71B13 OS=Arabidopsis thaliana GN=CYP71B13 PE=2 SV=1 310 494 4.0E-06
sp|O88833|CP4AA_MOUSE Cytochrome P450 4A10 OS=Mus musculus GN=Cyp4a10 PE=2 SV=2 269 499 4.0E-06
sp|Q42797|TCMO_SOYBN Trans-cinnamate 4-monooxygenase OS=Glycine max GN=CYP73A11 PE=2 SV=1 254 499 4.0E-06
sp|P08682|CP2E1_RABIT Cytochrome P450 2E1 OS=Oryctolagus cuniculus GN=CYP2E1 PE=2 SV=2 263 515 5.0E-06
sp|Q01361|CP2DE_BOVIN Cytochrome P450 2D14 OS=Bos taurus GN=CYP2D14 PE=2 SV=2 234 518 5.0E-06
sp|Q4H4C3|CP1A2_MACFU Cytochrome P450 1A2 OS=Macaca fuscata fuscata GN=CYP1A2 PE=2 SV=3 273 501 6.0E-06
sp|Q1PS23|AMO_ARTAN Amorpha-4,11-diene 12-monooxygenase OS=Artemisia annua GN=CYP71AV1 PE=1 SV=1 265 503 6.0E-06
sp|Q9VFP1|CP6D5_DROME Probable cytochrome P450 6d5 OS=Drosophila melanogaster GN=Cyp6d5 PE=2 SV=1 305 521 6.0E-06
sp|E3W9C4|C71A1_ZINZE Alpha-humulene 10-hydroxylase OS=Zingiber zerumbet GN=CYP71BA1 PE=1 SV=1 298 498 6.0E-06
sp|Q9D816|CP255_MOUSE Cytochrome P450 2C55 OS=Mus musculus GN=Cyp2c55 PE=1 SV=1 258 499 6.0E-06
sp|P05180|CP2H1_CHICK Cytochrome P450 2H1 OS=Gallus gallus GN=CYP2H1 PE=2 SV=1 214 499 6.0E-06
sp|P51590|CP2J3_RAT Cytochrome P450 2J3 OS=Rattus norvegicus GN=Cyp2j3 PE=2 SV=1 212 494 6.0E-06
sp|D5J9U8|GAO_LACSA Germacrene A oxidase OS=Lactuca sativa GN=GAO1 PE=1 SV=1 265 503 7.0E-06
sp|A3A871|C71Z6_ORYSJ Ent-isokaurene C2-hydroxylase OS=Oryza sativa subsp. japonica GN=CYP71Z6 PE=1 SV=1 309 511 7.0E-06
sp|O62671|CP241_CANLF Cytochrome P450 2C41 OS=Canis lupus familiaris GN=CYP2C41 PE=2 SV=1 254 499 8.0E-06
sp|Q55AJ4|C516B_DICDI Probable cytochrome P450 516B1 OS=Dictyostelium discoideum GN=cyp516B1 PE=3 SV=1 257 506 9.0E-06
sp|Q9V4U9|C6A13_DROME Probable cytochrome P450 6a13 OS=Drosophila melanogaster GN=Cyp6a13 PE=2 SV=1 257 500 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005506 iron ion binding Yes
GO:0004497 monooxygenase activity Yes
GO:0016705 oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen Yes
GO:0020037 heme binding Yes
GO:0046914 transition metal ion binding No
GO:0046872 metal ion binding No
GO:0005488 binding No
GO:0097159 organic cyclic compound binding No
GO:0016491 oxidoreductase activity No
GO:0003824 catalytic activity No
GO:0046906 tetrapyrrole binding No
GO:0003674 molecular_function No
GO:0043169 cation binding No
GO:0043167 ion binding No
GO:1901363 heterocyclic compound binding No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Endoplasmic reticulum Signal peptide|Transmembrane domain 0.2048 0.098 0.2751 0.0915 0.1865 0.0489 0.7866 0.1628 0.5905 0.0105

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

Gene cluster ID Type of secondary metabolism gene
Cluster 7 Decorating

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup63
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6183
Ophiocordyceps australis 1348a (Ghana) OphauG2|6246
Ophiocordyceps australis map64 (Brazil) OphauB2|1391
Ophiocordyceps australis map64 (Brazil) OphauB2|2981
Ophiocordyceps australis map64 (Brazil) OphauB2|2982
Ophiocordyceps australis map64 (Brazil) OphauB2|4757
Ophiocordyceps camponoti-floridani Ophcf2|02169
Ophiocordyceps camponoti-floridani Ophcf2|05915
Ophiocordyceps camponoti-floridani Ophcf2|04805
Ophiocordyceps camponoti-rufipedis Ophun1|6198
Ophiocordyceps camponoti-rufipedis Ophun1|5787
Ophiocordyceps kimflemingae Ophio5|1107
Ophiocordyceps kimflemingae Ophio5|2267
Ophiocordyceps kimflemingae Ophio5|2268 (this protein)
Ophiocordyceps kimflemingae Ophio5|3035
Ophiocordyceps subramaniannii Hirsu2|5140
Ophiocordyceps subramaniannii Hirsu2|4439

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|2268
MLKELNLTSLEPAWPQATAAAAVIILALILIRHLDYEKTVNVPVVGPAAGFTKWIAAVRNVWAARDSIHQGYSKY
SRSAFQIPTMTRMDVFLCDRAMTREYYSLDDEHMSFQAAMSEEFQFKYSLPGQQHDIRKIPNSVIGKALSWQKAR
ANNPQDPFFAEFSKEFLHGFLQEMDTFRRNQKPSSGLSFFFSHPAEPSSEWMTVPCFPLALKIVARLTTKSLFGE
PLCRNDYFLDLCCQFADAVPRVAMVLRCFPAFARPYVAKHLAGTKLVQKLRTFVLGEVTTRRSSRPKNPLKDLLD
FVMNWADEQEYSWSDLEVSDMIINVVFAALHTSSQLVTHTIFELATRPEYVPELREEIQQCFEAHGEGSKAAVDA
MYKVDSFIKETQRCNVLDASALARLVLKPYTFSNGLHVPQGTYIFTPNSPLLEDERFYKDPGQFDGLRFARMRND
VKLKASCPLTSTSEHSMHFGIGRNACPGRFMVSDEVKLVMIHLLLNMELAMENFGPRPKNVAFGKFMLPDMKAKI
WLKKATPRVS
Coding >Ophio5|2268
ATGCTCAAGGAACTCAACTTGACCAGCTTGGAGCCAGCATGGCCACAAGCCACCGCCGCCGCCGCCGTCATCATA
CTCGCCCTCATCCTCATCAGACACCTCGACTACGAAAAGACGGTCAACGTGCCCGTCGTCGGTCCAGCTGCCGGC
TTCACGAAATGGATTGCCGCAGTCCGTAACGTGTGGGCGGCCCGTGATTCCATTCACCAGGGCTACTCCAAGTAT
AGCCGGTCGGCATTCCAGATACCGACCATGACCCGCATGGACGTCTTCCTCTGCGACCGGGCCATGACGAGAGAG
TACTACTCCCTCGACGACGAACACATGTCCTTCCAGGCCGCCATGTCCGAGGAGTTTCAGTTCAAGTATTCGCTA
CCCGGCCAGCAGCACGACATCCGCAAGATTCCCAACTCGGTGATAGGCAAGGCCCTGAGCTGGCAAAAGGCTCGT
GCCAACAACCCGCAAGACCCCTTCTTCGCCGAATTCTCCAAAGAGTTCCTGCACGGCTTCTTGCAGGAGATGGAC
ACTTTCCGCCGGAATCAGAAGCCCTCTTCTGGCCTGTCCTTTTTTTTCTCTCACCCAGCCGAGCCGAGCTCCGAG
TGGATGACGGTGCCTTGCTTTCCCCTTGCCCTGAAGATTGTTGCCCGTCTCACGACAAAGTCTCTCTTCGGAGAG
CCGCTCTGTCGGAACGACTACTTTCTCGACTTGTGTTGCCAGTTTGCAGATGCCGTGCCTCGGGTGGCCATGGTG
TTGCGCTGCTTTCCTGCTTTTGCTAGGCCCTACGTCGCCAAACATCTGGCTGGGACGAAGCTTGTGCAAAAGCTG
CGGACTTTTGTTCTCGGCGAGGTCACCACCAGGAGAAGCTCTCGTCCGAAGAATCCCCTCAAGGATCTTCTCGAC
TTTGTCATGAACTGGGCCGATGAGCAGGAGTACAGCTGGAGCGACTTGGAGGTCTCGGATATGATCATCAACGTC
GTCTTCGCTGCTCTGCACACCTCTAGTCAATTGGTCACTCATACCATCTTTGAGCTCGCCACTCGTCCAGAGTAT
GTGCCAGAGCTCCGCGAAGAGATACAGCAATGCTTCGAAGCCCACGGAGAGGGCTCCAAGGCGGCCGTCGACGCC
ATGTACAAGGTGGACAGCTTCATCAAGGAGACGCAGAGATGCAACGTCCTCGACGCCTCTGCCCTCGCAAGACTG
GTCCTGAAGCCTTACACCTTCTCCAACGGGCTGCACGTTCCCCAAGGCACGTACATCTTCACACCCAACTCGCCC
TTGCTGGAAGACGAGCGCTTCTACAAGGACCCGGGGCAGTTCGACGGTCTGCGCTTTGCTCGGATGCGCAACGAC
GTCAAGCTCAAGGCCTCGTGCCCCCTGACGTCCACCAGCGAGCACAGCATGCACTTTGGTATAGGTCGCAACGCT
TGTCCCGGCCGCTTCATGGTATCGGATGAGGTTAAGCTGGTCATGATTCATCTTCTCCTCAACATGGAGCTTGCC
ATGGAGAACTTTGGCCCACGGCCCAAGAACGTGGCCTTTGGCAAGTTTATGTTGCCGGATATGAAGGCCAAGATC
TGGCTGAAGAAGGCGACACCGCGGGTCAGC
Transcript >Ophio5|2268
ATGCTCAAGGAACTCAACTTGACCAGCTTGGAGCCAGCATGGCCACAAGCCACCGCCGCCGCCGCCGTCATCATA
CTCGCCCTCATCCTCATCAGACACCTCGACTACGAAAAGACGGTCAACGTGCCCGTCGTCGGTCCAGCTGCCGGC
TTCACGAAATGGATTGCCGCAGTCCGTAACGTGTGGGCGGCCCGTGATTCCATTCACCAGGGCTACTCCAAGTAT
AGCCGGTCGGCATTCCAGATACCGACCATGACCCGCATGGACGTCTTCCTCTGCGACCGGGCCATGACGAGAGAG
TACTACTCCCTCGACGACGAACACATGTCCTTCCAGGCCGCCATGTCCGAGGAGTTTCAGTTCAAGTATTCGCTA
CCCGGCCAGCAGCACGACATCCGCAAGATTCCCAACTCGGTGATAGGCAAGGCCCTGAGCTGGCAAAAGGCTCGT
GCCAACAACCCGCAAGACCCCTTCTTCGCCGAATTCTCCAAAGAGTTCCTGCACGGCTTCTTGCAGGAGATGGAC
ACTTTCCGCCGGAATCAGAAGCCCTCTTCTGGCCTGTCCTTTTTTTTCTCTCACCCAGCCGAGCCGAGCTCCGAG
TGGATGACGGTGCCTTGCTTTCCCCTTGCCCTGAAGATTGTTGCCCGTCTCACGACAAAGTCTCTCTTCGGAGAG
CCGCTCTGTCGGAACGACTACTTTCTCGACTTGTGTTGCCAGTTTGCAGATGCCGTGCCTCGGGTGGCCATGGTG
TTGCGCTGCTTTCCTGCTTTTGCTAGGCCCTACGTCGCCAAACATCTGGCTGGGACGAAGCTTGTGCAAAAGCTG
CGGACTTTTGTTCTCGGCGAGGTCACCACCAGGAGAAGCTCTCGTCCGAAGAATCCCCTCAAGGATCTTCTCGAC
TTTGTCATGAACTGGGCCGATGAGCAGGAGTACAGCTGGAGCGACTTGGAGGTCTCGGATATGATCATCAACGTC
GTCTTCGCTGCTCTGCACACCTCTAGTCAATTGGTCACTCATACCATCTTTGAGCTCGCCACTCGTCCAGAGTAT
GTGCCAGAGCTCCGCGAAGAGATACAGCAATGCTTCGAAGCCCACGGAGAGGGCTCCAAGGCGGCCGTCGACGCC
ATGTACAAGGTGGACAGCTTCATCAAGGAGACGCAGAGATGCAACGTCCTCGACGCCTCTGCCCTCGCAAGACTG
GTCCTGAAGCCTTACACCTTCTCCAACGGGCTGCACGTTCCCCAAGGCACGTACATCTTCACACCCAACTCGCCC
TTGCTGGAAGACGAGCGCTTCTACAAGGACCCGGGGCAGTTCGACGGTCTGCGCTTTGCTCGGATGCGCAACGAC
GTCAAGCTCAAGGCCTCGTGCCCCCTGACGTCCACCAGCGAGCACAGCATGCACTTTGGTATAGGTCGCAACGCT
TGTCCCGGCCGCTTCATGGTATCGGATGAGGTTAAGCTGGTCATGATTCATCTTCTCCTCAACATGGAGCTTGCC
ATGGAGAACTTTGGCCCACGGCCCAAGAACGTGGCCTTTGGCAAGTTTATGTTGCCGGATATGAAGGCCAAGATC
TGGCTGAAGAAGGCGACACCGCGGGTCAGCTGA
Gene >Ophio5|2268
ATGCTCAAGGAACTCAACTTGACCAGCTTGGAGCCAGCATGGCCACAAGCCACCGCCGCCGCCGCCGTCATCATA
CTCGCCCTCATCCTCATCAGACACCTCGACTACGAAAAGACGGTTCGAAATGACCACAACCCGTCGACGAGACGC
AAGACGCTGCTGATGAGAGGAAAAAAAAAAAAAGGTCAACGTGCCCGTCGTCGGTCCAGCTGCCGGCTTCACGAA
ATGGATTGCCGCAGTCCGTAACGTGTGGGCGGCCCGTGATTCCATTCACCAGGGCTACTCCAAGGCAAGTCGACA
GCCCCGGACCTACGAGACAGATGTGAACATGATTCTCACTCAGAAGCCCCCCTCCCCTGTTACAGTATAGCCGGT
CGGCATTCCAGATACCGACCATGACCCGCATGGACGTCTTCCTCTGCGACCGGGCCATGACGAGAGAGTACTACT
CCCTCGACGACGAACACATGTCCTTCCAGGCCGCCATGTCCGAGGTTTGTCACTCCTGTCCTGTCCGGGGGGAAA
ATCGAGGCGGGCAACTGACGACTAGGTCGACAGGAGTTTCAGTTCAAGTATTCGCTACCCGGCCAGCAGCACGAC
ATCCGCAAGATTCCCAACTCGGTGATAGGCAAGGCCCTGAGCTGGCAAAAGGCTCGTGCCAACAACCCGCAAGAC
CCCTTCTTCGCCGAATTCTCCAAAGAGTTCCTGCACGGCTTCTTGCAGGAGATGGACACTTTCCGCCGGAATCAG
AAGCCCTCTTCTGGCCTGTCCTTTTTTTTCTCTCACCCAGCCGAGCCGAGCTCCGAGTGGATGACGGTGCCTTGC
TTTCCCCTTGCCCTGAAGATTGTTGCCCGTCTCACGACAAAGTCTCTCTTCGGAGAGCCGCTCTGTCGGAACGAC
TACTTTCTCGACTTGTGTTGCCAGTTTGCAGATGCCGTGCCTCGGGTGGCCATGGTGTTGCGCTGCTTTCCTGCT
TTTGCTAGGCCGTAAGCGCTCCGGCAAACGGCCCCATGTGTGCTGTAGATTGTTGAGACTCATTGACTGACCGAA
CAACTTCCTCCTCCTCTTCTTCTTCTTCTTCTTCTCCTCCTCTTTCCTTTGTAGCTACGTCGCCAAACATCTGGC
TGGGACGAAGCTTGTGCAAAAGCTGCGGACTTTTGTTCTCGGCGAGGTCACCACCAGGAGAAGCTCTCGTCCGAA
GAATCCCCTCAAGGTCAGTAAAAGGGGCCAACTATTCTATCGTGCCTCTGAGAACGACTGTGGAAGCTGAAAGCG
GCGTCAGGATCTTCTCGACTTTGTCATGAACTGGGCCGATGAGCAGGAGTACAGCTGGAGCGACTTGGAGGTCTC
GGATATGATCATCAACGTCGTCTTCGCTGCTCTGCACACCTCTAGTCAAGTATCACACTCGCCTCATCTCGCTAG
GATCAGTCTTCGGGTCAGTTCTGGCTAATCTTTATCCCATTGCAGTTGGTCACTCATACCATCTTTGAGCTCGCC
ACTCGTCCAGAGTATGTGCCAGAGCTCCGCGAAGAGATACAGCAATGCTTCGAAGCCCACGGAGAGGGCTCCAAG
GCGGCCGTCGACGCCATGTACAAGGTGGACAGCTTCATCAAGGAGACGCAGAGATGCAACGTCCTCGACGCCTGT
ACGTTTCTGTTGCCTGAGAAGCTCCGAACAAAAGACAGCTGACGAAGCCGCTCAGCTGCCCTCGCAAGACTGGTC
CTGAAGCCTTACACCTTCTCCAACGGGCTGCACGTTCCCCAAGGCACGTACATCTTCACACCCAACTCGCCCTTG
CTGGAAGACGAGCGCTTCTACAAGGACCCGGGGCAGTTCGACGGTCTGCGCTTTGCTCGGATGCGCAACGACGTC
AAGCTCAAGGCCTCGTGCCCCCTGACGTCCACCAGCGAGCACAGCATGCACTTTGGTATAGGTCGCAACGCTTGT
CCCGGCCGCTTCATGGTATCGGATGAGGTTAAGCTGGTCATGATTCATCTTCTCCTCAACATGGAGCTTGCCATG
GAGAACTTTGGCCCACGGCCCAAGAACGTGGCCTTTGGCAAGTTTATGTTGCCGGATATGAAGGCCAAGATCTGG
CTGAAGAAGGCGACACCGCGGGTCAGCTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail