Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|2267
Gene name
Locationscaffold_194:13292..14810
Strand+
Gene length (bp)1518
Transcript length (bp)1404
Coding sequence length (bp)1401
Protein length (aa) 467

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01494 FAD_binding_3 FAD binding domain 1.7E-22 12 348

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9I0Q0|PQSH_PSEAE 2-heptyl-3-hydroxy-4(1H)-quinolone synthase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=pqsH PE=3 SV=1 12 342 4.0E-18
sp|Q88FY2|6HN3M_PSEPK 6-hydroxynicotinate 3-monooxygenase OS=Pseudomonas putida (strain KT2440) GN=nicC PE=1 SV=1 38 343 2.0E-17
sp|Q02N79|PQSH_PSEAB 2-heptyl-3-hydroxy-4(1H)-quinolone synthase OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=pqsH PE=1 SV=1 12 342 7.0E-17
sp|P86491|6HN3M_PSEFL 6-hydroxynicotinate 3-monooxygenase OS=Pseudomonas fluorescens PE=1 SV=1 39 343 1.0E-15
sp|A6T923|HPXO_KLEP7 FAD-dependent urate hydroxylase OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=hpxO PE=1 SV=1 12 346 2.0E-15
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9I0Q0|PQSH_PSEAE 2-heptyl-3-hydroxy-4(1H)-quinolone synthase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=pqsH PE=3 SV=1 12 342 4.0E-18
sp|Q88FY2|6HN3M_PSEPK 6-hydroxynicotinate 3-monooxygenase OS=Pseudomonas putida (strain KT2440) GN=nicC PE=1 SV=1 38 343 2.0E-17
sp|Q02N79|PQSH_PSEAB 2-heptyl-3-hydroxy-4(1H)-quinolone synthase OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=pqsH PE=1 SV=1 12 342 7.0E-17
sp|P86491|6HN3M_PSEFL 6-hydroxynicotinate 3-monooxygenase OS=Pseudomonas fluorescens PE=1 SV=1 39 343 1.0E-15
sp|A6T923|HPXO_KLEP7 FAD-dependent urate hydroxylase OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=hpxO PE=1 SV=1 12 346 2.0E-15
sp|B6D1N4|HPXO_KLEPN FAD-dependent urate hydroxylase OS=Klebsiella pneumoniae GN=hpxO PE=3 SV=1 12 346 2.0E-15
sp|Q9F131|3HBH1_PSEAC 3-hydroxybenzoate 6-hydroxylase 1 OS=Pseudomonas alcaligenes GN=xlnD PE=1 SV=1 13 381 4.0E-15
sp|Q40412|ABA2_NICPL Zeaxanthin epoxidase, chloroplastic OS=Nicotiana plumbaginifolia GN=ABA2 PE=1 SV=1 2 338 5.0E-13
sp|B5B0J6|HPXO_KLEOX FAD-dependent urate hydroxylase OS=Klebsiella oxytoca GN=hpxO PE=3 SV=1 12 343 1.0E-12
sp|Q9FGC7|ZEP_ARATH Zeaxanthin epoxidase, chloroplastic OS=Arabidopsis thaliana GN=ZEP PE=1 SV=1 13 344 2.0E-12
sp|P93236|ABA2_SOLLC Zeaxanthin epoxidase, chloroplastic OS=Solanum lycopersicum PE=2 SV=1 7 371 9.0E-12
sp|Q3S4B7|3HBH_POLNA 3-hydroxybenzoate 6-hydroxylase OS=Polaromonas naphthalenivorans (strain CJ2) GN=nagX PE=1 SV=1 35 341 3.0E-11
sp|O81360|ABA2_PRUAR Zeaxanthin epoxidase, chloroplastic OS=Prunus armeniaca PE=2 SV=1 3 338 2.0E-10
sp|Q96375|ABA2_CAPAN Zeaxanthin epoxidase, chloroplastic OS=Capsicum annuum PE=2 SV=1 5 338 2.0E-10
sp|Q53552|NHG2_PSEPU Salicylate hydroxylase OS=Pseudomonas putida GN=nahG PE=4 SV=1 12 366 1.0E-09
sp|Q5EXK1|3HBH_KLEOX 3-hydroxybenzoate 6-hydroxylase OS=Klebsiella oxytoca GN=mhbM PE=1 SV=1 27 394 2.0E-08
sp|P23262|NHG1_PSEPU Salicylate hydroxylase OS=Pseudomonas putida GN=nahG PE=1 SV=4 49 341 6.0E-08
sp|Q0QFQ1|3HBH2_PSEAC 3-hydroxybenzoate 6-hydroxylase 2 OS=Pseudomonas alcaligenes GN=hbzD PE=2 SV=1 133 341 2.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0071949 FAD binding Yes
GO:0036094 small molecule binding No
GO:0097159 organic cyclic compound binding No
GO:0005488 binding No
GO:1901265 nucleoside phosphate binding No
GO:0000166 nucleotide binding No
GO:0003674 molecular_function No
GO:0043167 ion binding No
GO:0043168 anion binding No
GO:1901363 heterocyclic compound binding No
GO:0050660 flavin adenine dinucleotide binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 28 0.5

Transmembrane Domains

Domain # Start End Length
1 440 462 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
SC16a Pure fungal culture 0.09 0.00 0.31
CcL In ants, during behavior modification 286.67 0.00 584.93
CcD In ants, recently dead 7.15 2.44 11.87

Differential expression

Label1 Label2 Q-value Significant difference
SC16a CcL 0.184192 no
SC16a CcD 0.184192 no
CcL CcD 0.000286 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|2267
MTPLATMPRDDFKVLIIGGSIAGLTLAHCLEKLNMSYEILEQGRDISPQLGASVGVLPNGARILDQLGIFDEVEE
AIEPLTFARIRFPDGFFFHSQYPSVLRSRFGYPLAFLERQRFLEILYEKLEGKKHVHTGQRVVRVDDEGDRAVVR
TADGKEHFGHLVVGADGVHSIVRSEIWRHDREAGTGMVTEKEKSSLRIDYACVYGISSGVQGVAAGVQLSLLDHG
LTIHVFNGKDTKAYWFVIIKTDRIYEQGERRQYSAEDARKTCESISSKLIDENLAFGHLWERCQVCTMTPLEEGN
FETWNRGRLVCVGDAVRKVTPNIGQGANMAIEDVAALANALWEQERPRKPASIGAAVGAVRLHRTRAVCRQSEFL
TRMQAHQGLLKQLLVRYLLPALHDIPAGSSAVVLGGAQRLAFAPLPERASKQASSWALARTLVAAFAPRPVVAAL
LCIAALVAWAAVQAISW
Coding >Ophio5|2267
ATGACTCCTCTTGCTACCATGCCCAGGGACGACTTCAAGGTTCTGATTATCGGCGGGTCCATCGCCGGTCTTACG
CTCGCTCACTGCCTAGAGAAGCTGAACATGTCGTACGAAATACTCGAGCAGGGCCGTGATATAAGCCCCCAGCTC
GGGGCTTCCGTCGGCGTCTTGCCCAACGGAGCCCGTATCTTAGATCAGCTGGGCATCTTTGACGAGGTCGAGGAG
GCTATAGAGCCCCTAACGTTTGCACGGATCCGCTTCCCGGACGGCTTCTTCTTCCATAGCCAGTACCCTTCGGTG
CTGCGATCTCGCTTTGGATATCCGCTGGCGTTTCTGGAACGCCAGCGATTCCTCGAGATACTCTATGAAAAGCTC
GAGGGCAAGAAACATGTCCATACGGGCCAGCGAGTGGTGCGGGTGGATGACGAGGGTGATAGGGCTGTTGTCCGC
ACCGCTGATGGCAAGGAGCATTTTGGCCATCTGGTGGTCGGTGCCGACGGAGTGCACAGCATTGTGAGATCAGAG
ATTTGGAGGCACGACCGCGAAGCCGGCACAGGGATGGTGACGGAAAAGGAGAAGTCGAGCCTGAGGATCGACTAC
GCCTGCGTGTATGGAATCTCTTCCGGCGTACAGGGGGTCGCAGCCGGAGTGCAGCTATCGCTTCTGGACCACGGA
CTGACGATTCACGTCTTCAATGGCAAAGACACCAAGGCCTACTGGTTCGTCATCATCAAGACGGACCGAATATAC
GAGCAGGGCGAAAGACGTCAGTACAGCGCCGAAGACGCCCGGAAGACGTGCGAGAGCATCAGCTCGAAGCTCATC
GACGAGAATCTGGCTTTTGGCCATCTCTGGGAACGATGCCAGGTCTGCACCATGACTCCGCTGGAGGAAGGCAAC
TTTGAGACGTGGAATAGGGGCAGACTGGTGTGTGTGGGCGATGCGGTGCGGAAGGTGACGCCCAACATCGGCCAG
GGCGCCAACATGGCCATCGAGGACGTGGCCGCTCTGGCAAACGCCCTGTGGGAACAAGAACGGCCTCGGAAGCCG
GCCTCGATAGGAGCCGCCGTCGGAGCCGTCCGCCTGCATCGTACGCGCGCCGTATGCCGCCAGTCGGAGTTTCTG
ACGCGCATGCAAGCTCATCAAGGACTCTTGAAGCAGTTGCTAGTACGCTATCTGCTTCCGGCCCTTCACGACATT
CCTGCCGGCTCTTCGGCCGTCGTCCTTGGCGGCGCTCAGAGGCTGGCTTTTGCCCCCTTGCCTGAGAGGGCCTCG
AAACAGGCTTCGTCTTGGGCTTTGGCCCGTACCCTCGTCGCTGCTTTCGCGCCTAGGCCCGTCGTTGCGGCCCTG
CTTTGCATCGCTGCGCTGGTGGCTTGGGCGGCTGTGCAGGCTATCTCCTGG
Transcript >Ophio5|2267
ATGACTCCTCTTGCTACCATGCCCAGGGACGACTTCAAGGTTCTGATTATCGGCGGGTCCATCGCCGGTCTTACG
CTCGCTCACTGCCTAGAGAAGCTGAACATGTCGTACGAAATACTCGAGCAGGGCCGTGATATAAGCCCCCAGCTC
GGGGCTTCCGTCGGCGTCTTGCCCAACGGAGCCCGTATCTTAGATCAGCTGGGCATCTTTGACGAGGTCGAGGAG
GCTATAGAGCCCCTAACGTTTGCACGGATCCGCTTCCCGGACGGCTTCTTCTTCCATAGCCAGTACCCTTCGGTG
CTGCGATCTCGCTTTGGATATCCGCTGGCGTTTCTGGAACGCCAGCGATTCCTCGAGATACTCTATGAAAAGCTC
GAGGGCAAGAAACATGTCCATACGGGCCAGCGAGTGGTGCGGGTGGATGACGAGGGTGATAGGGCTGTTGTCCGC
ACCGCTGATGGCAAGGAGCATTTTGGCCATCTGGTGGTCGGTGCCGACGGAGTGCACAGCATTGTGAGATCAGAG
ATTTGGAGGCACGACCGCGAAGCCGGCACAGGGATGGTGACGGAAAAGGAGAAGTCGAGCCTGAGGATCGACTAC
GCCTGCGTGTATGGAATCTCTTCCGGCGTACAGGGGGTCGCAGCCGGAGTGCAGCTATCGCTTCTGGACCACGGA
CTGACGATTCACGTCTTCAATGGCAAAGACACCAAGGCCTACTGGTTCGTCATCATCAAGACGGACCGAATATAC
GAGCAGGGCGAAAGACGTCAGTACAGCGCCGAAGACGCCCGGAAGACGTGCGAGAGCATCAGCTCGAAGCTCATC
GACGAGAATCTGGCTTTTGGCCATCTCTGGGAACGATGCCAGGTCTGCACCATGACTCCGCTGGAGGAAGGCAAC
TTTGAGACGTGGAATAGGGGCAGACTGGTGTGTGTGGGCGATGCGGTGCGGAAGGTGACGCCCAACATCGGCCAG
GGCGCCAACATGGCCATCGAGGACGTGGCCGCTCTGGCAAACGCCCTGTGGGAACAAGAACGGCCTCGGAAGCCG
GCCTCGATAGGAGCCGCCGTCGGAGCCGTCCGCCTGCATCGTACGCGCGCCGTATGCCGCCAGTCGGAGTTTCTG
ACGCGCATGCAAGCTCATCAAGGACTCTTGAAGCAGTTGCTAGTACGCTATCTGCTTCCGGCCCTTCACGACATT
CCTGCCGGCTCTTCGGCCGTCGTCCTTGGCGGCGCTCAGAGGCTGGCTTTTGCCCCCTTGCCTGAGAGGGCCTCG
AAACAGGCTTCGTCTTGGGCTTTGGCCCGTACCCTCGTCGCTGCTTTCGCGCCTAGGCCCGTCGTTGCGGCCCTG
CTTTGCATCGCTGCGCTGGTGGCTTGGGCGGCTGTGCAGGCTATCTCCTGGTGA
Gene >Ophio5|2267
ATGACTCCTCTTGCTACCATGCCCAGGGACGACTTCAAGGTTCTGATTATCGGCGGGTCCATCGCCGGTCTTACG
CTCGCTCACTGCCTAGAGAAGCTGAACATGTCGTACGAAATACTCGAGCAGGGCCGTGATATAAGCCCCCAGCTC
GGGGCTTCCGTCGGCGTCTTGCCCAACGGAGCCCGTATCTTAGATCAGCTGGGCATCTTTGACGAGGTCGAGGAG
GCTATAGAGCCCCTAACGTTTGCACGGATCCGCTTCCCGGACGGCTTCTTCTTCCATAGCCAGTACCCTTCGGTG
CTGCGATCTCGGTCCGTCGTGCCAACTCCAAGACGCACGCTGGCTGACAAGGTCTAAGCTGACTGAATACAGCTT
TGGATATCCGCTGGCGTTTCTGGAACGCCAGCGATTCCTCGAGATACTCTATGAAAAGCTCGAGGGCAAGAAACA
TGTCCATACGGGCCAGCGAGTGGTGCGGGTGGATGACGAGGGTGATAGGGCTGTTGTCCGCACCGCTGATGGCAA
GGAGCATTTTGGCCATCTGGTGGTCGGTGCCGACGGAGTGCACAGCATTGTGAGATCAGAGATTTGGAGGCACGA
CCGCGAAGCCGGCACAGGGATGGTGACGGAAAAGGAGAAGTCGAGTAAGTCGGCCGTTTTTCCTGCAATGAAAGA
TGGATGGCTAAAGATGGAAAAGGCCTGAGGATCGACTACGCCTGCGTGTATGGAATCTCTTCCGGCGTACAGGGG
GTCGCAGCCGGAGTGCAGCTATCGCTTCTGGACCACGGACTGACGATTCACGTCTTCAATGGCAAAGACACCAAG
GCCTACTGGTTCGTCATCATCAAGACGGACCGAATATACGAGCAGGGCGAAAGACGTCAGTACAGCGCCGAAGAC
GCCCGGAAGACGTGCGAGAGCATCAGCTCGAAGCTCATCGACGAGAATCTGGCTTTTGGCCATCTCTGGGAACGA
TGCCAGGTCTGCACCATGACTCCGCTGGAGGAAGGCAACTTTGAGACGTGGAATAGGGGCAGACTGGTGTGTGTG
GGCGATGCGGTGCGGAAGGTGACGCCCAACATCGGCCAGGGCGCCAACATGGCCATCGAGGACGTGGCCGCTCTG
GCAAACGCCCTGTGGGAACAAGAACGGCCTCGGAAGCCGGCCTCGATAGGAGCCGCCGTCGGAGCCGTCCGCCTG
CATCGTACGCGCGCCGTATGCCGCCAGTCGGAGTTTCTGACGCGCATGCAAGCTCATCAAGGACTCTTGAAGCAG
TTGCTAGTACGCTATCTGCTTCCGGCCCTTCACGACATTCCTGCCGGCTCTTCGGCCGTCGTCCTTGGCGGCGCT
CAGAGGCTGGCTTTTGCCCCCTTGCCTGAGAGGGCCTCGAAACAGGCTTCGTCTTGGGCTTTGGCCCGTACCCTC
GTCGCTGCTTTCGCGCCTAGGCCCGTCGTTGCGGCCCTGCTTTGCATCGCTGCGCTGGTGGCTTGGGCGGCTGTG
CAGGCTATCTCCTGGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail