Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|2267
Gene name
Locationscaffold_194:13292..14810
Strand+
Gene length (bp)1518
Transcript length (bp)1404
Coding sequence length (bp)1401
Protein length (aa) 467

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01494 FAD_binding_3 FAD binding domain 1.7E-22 12 348

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9I0Q0|PQSH_PSEAE 2-heptyl-3-hydroxy-4(1H)-quinolone synthase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=pqsH PE=3 SV=1 12 342 4.0E-18
sp|Q88FY2|6HN3M_PSEPK 6-hydroxynicotinate 3-monooxygenase OS=Pseudomonas putida (strain KT2440) GN=nicC PE=1 SV=1 38 343 2.0E-17
sp|Q02N79|PQSH_PSEAB 2-heptyl-3-hydroxy-4(1H)-quinolone synthase OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=pqsH PE=1 SV=1 12 342 7.0E-17
sp|P86491|6HN3M_PSEFL 6-hydroxynicotinate 3-monooxygenase OS=Pseudomonas fluorescens PE=1 SV=1 39 343 1.0E-15
sp|A6T923|HPXO_KLEP7 FAD-dependent urate hydroxylase OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=hpxO PE=1 SV=1 12 346 2.0E-15
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9I0Q0|PQSH_PSEAE 2-heptyl-3-hydroxy-4(1H)-quinolone synthase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=pqsH PE=3 SV=1 12 342 4.0E-18
sp|Q88FY2|6HN3M_PSEPK 6-hydroxynicotinate 3-monooxygenase OS=Pseudomonas putida (strain KT2440) GN=nicC PE=1 SV=1 38 343 2.0E-17
sp|Q02N79|PQSH_PSEAB 2-heptyl-3-hydroxy-4(1H)-quinolone synthase OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=pqsH PE=1 SV=1 12 342 7.0E-17
sp|P86491|6HN3M_PSEFL 6-hydroxynicotinate 3-monooxygenase OS=Pseudomonas fluorescens PE=1 SV=1 39 343 1.0E-15
sp|A6T923|HPXO_KLEP7 FAD-dependent urate hydroxylase OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=hpxO PE=1 SV=1 12 346 2.0E-15
sp|B6D1N4|HPXO_KLEPN FAD-dependent urate hydroxylase OS=Klebsiella pneumoniae GN=hpxO PE=3 SV=1 12 346 2.0E-15
sp|Q9F131|3HBH1_PSEAC 3-hydroxybenzoate 6-hydroxylase 1 OS=Pseudomonas alcaligenes GN=xlnD PE=1 SV=1 13 381 4.0E-15
sp|Q40412|ABA2_NICPL Zeaxanthin epoxidase, chloroplastic OS=Nicotiana plumbaginifolia GN=ABA2 PE=1 SV=1 2 338 5.0E-13
sp|B5B0J6|HPXO_KLEOX FAD-dependent urate hydroxylase OS=Klebsiella oxytoca GN=hpxO PE=3 SV=1 12 343 1.0E-12
sp|Q9FGC7|ZEP_ARATH Zeaxanthin epoxidase, chloroplastic OS=Arabidopsis thaliana GN=ZEP PE=1 SV=1 13 344 2.0E-12
sp|P93236|ABA2_SOLLC Zeaxanthin epoxidase, chloroplastic OS=Solanum lycopersicum PE=2 SV=1 7 371 9.0E-12
sp|Q3S4B7|3HBH_POLNA 3-hydroxybenzoate 6-hydroxylase OS=Polaromonas naphthalenivorans (strain CJ2) GN=nagX PE=1 SV=1 35 341 3.0E-11
sp|O81360|ABA2_PRUAR Zeaxanthin epoxidase, chloroplastic OS=Prunus armeniaca PE=2 SV=1 3 338 2.0E-10
sp|Q96375|ABA2_CAPAN Zeaxanthin epoxidase, chloroplastic OS=Capsicum annuum PE=2 SV=1 5 338 2.0E-10
sp|Q53552|NHG2_PSEPU Salicylate hydroxylase OS=Pseudomonas putida GN=nahG PE=4 SV=1 12 366 1.0E-09
sp|Q5EXK1|3HBH_KLEOX 3-hydroxybenzoate 6-hydroxylase OS=Klebsiella oxytoca GN=mhbM PE=1 SV=1 27 394 2.0E-08
sp|P23262|NHG1_PSEPU Salicylate hydroxylase OS=Pseudomonas putida GN=nahG PE=1 SV=4 49 341 6.0E-08
sp|Q0QFQ1|3HBH2_PSEAC 3-hydroxybenzoate 6-hydroxylase 2 OS=Pseudomonas alcaligenes GN=hbzD PE=2 SV=1 133 341 2.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0071949 FAD binding Yes
GO:0036094 small molecule binding No
GO:0097159 organic cyclic compound binding No
GO:0005488 binding No
GO:1901265 nucleoside phosphate binding No
GO:0000166 nucleotide binding No
GO:0003674 molecular_function No
GO:0043167 ion binding No
GO:0043168 anion binding No
GO:1901363 heterocyclic compound binding No
GO:0050660 flavin adenine dinucleotide binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 28 0.5

Transmembrane Domains

Domain # Start End Length
1 440 462 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|2267
MTPLATMPRDDFKVLIIGGSIAGLTLAHCLEKLNMSYEILEQGRDISPQLGASVGVLPNGARILDQLGIFDEVEE
AIEPLTFARIRFPDGFFFHSQYPSVLRSRFGYPLAFLERQRFLEILYEKLEGKKHVHTGQRVVRVDDEGDRAVVR
TADGKEHFGHLVVGADGVHSIVRSEIWRHDREAGTGMVTEKEKSSLRIDYACVYGISSGVQGVAAGVQLSLLDHG
LTIHVFNGKDTKAYWFVIIKTDRIYEQGERRQYSAEDARKTCESISSKLIDENLAFGHLWERCQVCTMTPLEEGN
FETWNRGRLVCVGDAVRKVTPNIGQGANMAIEDVAALANALWEQERPRKPASIGAAVGAVRLHRTRAVCRQSEFL
TRMQAHQGLLKQLLVRYLLPALHDIPAGSSAVVLGGAQRLAFAPLPERASKQASSWALARTLVAAFAPRPVVAAL
LCIAALVAWAAVQAISW
Coding >Ophio5|2267
ATGACTCCTCTTGCTACCATGCCCAGGGACGACTTCAAGGTTCTGATTATCGGCGGGTCCATCGCCGGTCTTACG
CTCGCTCACTGCCTAGAGAAGCTGAACATGTCGTACGAAATACTCGAGCAGGGCCGTGATATAAGCCCCCAGCTC
GGGGCTTCCGTCGGCGTCTTGCCCAACGGAGCCCGTATCTTAGATCAGCTGGGCATCTTTGACGAGGTCGAGGAG
GCTATAGAGCCCCTAACGTTTGCACGGATCCGCTTCCCGGACGGCTTCTTCTTCCATAGCCAGTACCCTTCGGTG
CTGCGATCTCGCTTTGGATATCCGCTGGCGTTTCTGGAACGCCAGCGATTCCTCGAGATACTCTATGAAAAGCTC
GAGGGCAAGAAACATGTCCATACGGGCCAGCGAGTGGTGCGGGTGGATGACGAGGGTGATAGGGCTGTTGTCCGC
ACCGCTGATGGCAAGGAGCATTTTGGCCATCTGGTGGTCGGTGCCGACGGAGTGCACAGCATTGTGAGATCAGAG
ATTTGGAGGCACGACCGCGAAGCCGGCACAGGGATGGTGACGGAAAAGGAGAAGTCGAGCCTGAGGATCGACTAC
GCCTGCGTGTATGGAATCTCTTCCGGCGTACAGGGGGTCGCAGCCGGAGTGCAGCTATCGCTTCTGGACCACGGA
CTGACGATTCACGTCTTCAATGGCAAAGACACCAAGGCCTACTGGTTCGTCATCATCAAGACGGACCGAATATAC
GAGCAGGGCGAAAGACGTCAGTACAGCGCCGAAGACGCCCGGAAGACGTGCGAGAGCATCAGCTCGAAGCTCATC
GACGAGAATCTGGCTTTTGGCCATCTCTGGGAACGATGCCAGGTCTGCACCATGACTCCGCTGGAGGAAGGCAAC
TTTGAGACGTGGAATAGGGGCAGACTGGTGTGTGTGGGCGATGCGGTGCGGAAGGTGACGCCCAACATCGGCCAG
GGCGCCAACATGGCCATCGAGGACGTGGCCGCTCTGGCAAACGCCCTGTGGGAACAAGAACGGCCTCGGAAGCCG
GCCTCGATAGGAGCCGCCGTCGGAGCCGTCCGCCTGCATCGTACGCGCGCCGTATGCCGCCAGTCGGAGTTTCTG
ACGCGCATGCAAGCTCATCAAGGACTCTTGAAGCAGTTGCTAGTACGCTATCTGCTTCCGGCCCTTCACGACATT
CCTGCCGGCTCTTCGGCCGTCGTCCTTGGCGGCGCTCAGAGGCTGGCTTTTGCCCCCTTGCCTGAGAGGGCCTCG
AAACAGGCTTCGTCTTGGGCTTTGGCCCGTACCCTCGTCGCTGCTTTCGCGCCTAGGCCCGTCGTTGCGGCCCTG
CTTTGCATCGCTGCGCTGGTGGCTTGGGCGGCTGTGCAGGCTATCTCCTGG
Transcript >Ophio5|2267
ATGACTCCTCTTGCTACCATGCCCAGGGACGACTTCAAGGTTCTGATTATCGGCGGGTCCATCGCCGGTCTTACG
CTCGCTCACTGCCTAGAGAAGCTGAACATGTCGTACGAAATACTCGAGCAGGGCCGTGATATAAGCCCCCAGCTC
GGGGCTTCCGTCGGCGTCTTGCCCAACGGAGCCCGTATCTTAGATCAGCTGGGCATCTTTGACGAGGTCGAGGAG
GCTATAGAGCCCCTAACGTTTGCACGGATCCGCTTCCCGGACGGCTTCTTCTTCCATAGCCAGTACCCTTCGGTG
CTGCGATCTCGCTTTGGATATCCGCTGGCGTTTCTGGAACGCCAGCGATTCCTCGAGATACTCTATGAAAAGCTC
GAGGGCAAGAAACATGTCCATACGGGCCAGCGAGTGGTGCGGGTGGATGACGAGGGTGATAGGGCTGTTGTCCGC
ACCGCTGATGGCAAGGAGCATTTTGGCCATCTGGTGGTCGGTGCCGACGGAGTGCACAGCATTGTGAGATCAGAG
ATTTGGAGGCACGACCGCGAAGCCGGCACAGGGATGGTGACGGAAAAGGAGAAGTCGAGCCTGAGGATCGACTAC
GCCTGCGTGTATGGAATCTCTTCCGGCGTACAGGGGGTCGCAGCCGGAGTGCAGCTATCGCTTCTGGACCACGGA
CTGACGATTCACGTCTTCAATGGCAAAGACACCAAGGCCTACTGGTTCGTCATCATCAAGACGGACCGAATATAC
GAGCAGGGCGAAAGACGTCAGTACAGCGCCGAAGACGCCCGGAAGACGTGCGAGAGCATCAGCTCGAAGCTCATC
GACGAGAATCTGGCTTTTGGCCATCTCTGGGAACGATGCCAGGTCTGCACCATGACTCCGCTGGAGGAAGGCAAC
TTTGAGACGTGGAATAGGGGCAGACTGGTGTGTGTGGGCGATGCGGTGCGGAAGGTGACGCCCAACATCGGCCAG
GGCGCCAACATGGCCATCGAGGACGTGGCCGCTCTGGCAAACGCCCTGTGGGAACAAGAACGGCCTCGGAAGCCG
GCCTCGATAGGAGCCGCCGTCGGAGCCGTCCGCCTGCATCGTACGCGCGCCGTATGCCGCCAGTCGGAGTTTCTG
ACGCGCATGCAAGCTCATCAAGGACTCTTGAAGCAGTTGCTAGTACGCTATCTGCTTCCGGCCCTTCACGACATT
CCTGCCGGCTCTTCGGCCGTCGTCCTTGGCGGCGCTCAGAGGCTGGCTTTTGCCCCCTTGCCTGAGAGGGCCTCG
AAACAGGCTTCGTCTTGGGCTTTGGCCCGTACCCTCGTCGCTGCTTTCGCGCCTAGGCCCGTCGTTGCGGCCCTG
CTTTGCATCGCTGCGCTGGTGGCTTGGGCGGCTGTGCAGGCTATCTCCTGGTGA
Gene >Ophio5|2267
ATGACTCCTCTTGCTACCATGCCCAGGGACGACTTCAAGGTTCTGATTATCGGCGGGTCCATCGCCGGTCTTACG
CTCGCTCACTGCCTAGAGAAGCTGAACATGTCGTACGAAATACTCGAGCAGGGCCGTGATATAAGCCCCCAGCTC
GGGGCTTCCGTCGGCGTCTTGCCCAACGGAGCCCGTATCTTAGATCAGCTGGGCATCTTTGACGAGGTCGAGGAG
GCTATAGAGCCCCTAACGTTTGCACGGATCCGCTTCCCGGACGGCTTCTTCTTCCATAGCCAGTACCCTTCGGTG
CTGCGATCTCGGTCCGTCGTGCCAACTCCAAGACGCACGCTGGCTGACAAGGTCTAAGCTGACTGAATACAGCTT
TGGATATCCGCTGGCGTTTCTGGAACGCCAGCGATTCCTCGAGATACTCTATGAAAAGCTCGAGGGCAAGAAACA
TGTCCATACGGGCCAGCGAGTGGTGCGGGTGGATGACGAGGGTGATAGGGCTGTTGTCCGCACCGCTGATGGCAA
GGAGCATTTTGGCCATCTGGTGGTCGGTGCCGACGGAGTGCACAGCATTGTGAGATCAGAGATTTGGAGGCACGA
CCGCGAAGCCGGCACAGGGATGGTGACGGAAAAGGAGAAGTCGAGTAAGTCGGCCGTTTTTCCTGCAATGAAAGA
TGGATGGCTAAAGATGGAAAAGGCCTGAGGATCGACTACGCCTGCGTGTATGGAATCTCTTCCGGCGTACAGGGG
GTCGCAGCCGGAGTGCAGCTATCGCTTCTGGACCACGGACTGACGATTCACGTCTTCAATGGCAAAGACACCAAG
GCCTACTGGTTCGTCATCATCAAGACGGACCGAATATACGAGCAGGGCGAAAGACGTCAGTACAGCGCCGAAGAC
GCCCGGAAGACGTGCGAGAGCATCAGCTCGAAGCTCATCGACGAGAATCTGGCTTTTGGCCATCTCTGGGAACGA
TGCCAGGTCTGCACCATGACTCCGCTGGAGGAAGGCAACTTTGAGACGTGGAATAGGGGCAGACTGGTGTGTGTG
GGCGATGCGGTGCGGAAGGTGACGCCCAACATCGGCCAGGGCGCCAACATGGCCATCGAGGACGTGGCCGCTCTG
GCAAACGCCCTGTGGGAACAAGAACGGCCTCGGAAGCCGGCCTCGATAGGAGCCGCCGTCGGAGCCGTCCGCCTG
CATCGTACGCGCGCCGTATGCCGCCAGTCGGAGTTTCTGACGCGCATGCAAGCTCATCAAGGACTCTTGAAGCAG
TTGCTAGTACGCTATCTGCTTCCGGCCCTTCACGACATTCCTGCCGGCTCTTCGGCCGTCGTCCTTGGCGGCGCT
CAGAGGCTGGCTTTTGCCCCCTTGCCTGAGAGGGCCTCGAAACAGGCTTCGTCTTGGGCTTTGGCCCGTACCCTC
GTCGCTGCTTTCGCGCCTAGGCCCGTCGTTGCGGCCCTGCTTTGCATCGCTGCGCTGGTGGCTTGGGCGGCTGTG
CAGGCTATCTCCTGGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail