Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|2266
Gene name
Locationscaffold_194:10899..12725
Strand-
Gene length (bp)1826
Transcript length (bp)1494
Coding sequence length (bp)1491
Protein length (aa) 497

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00067 p450 Cytochrome P450 7.7E-41 143 471

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O94142|KO1_GIBFU Ent-kaurene oxidase OS=Gibberella fujikuroi GN=CYP503A1 PE=1 SV=1 32 496 1.0E-72
sp|Q701P2|KO1_GIBIN Ent-kaurene oxidase OS=Gibberella intermedia GN=CYP503A1 PE=1 SV=1 32 496 2.0E-72
sp|Q9Y7C8|LOVA_ASPTE Dihydromonacolin L monooxygenase LovA OS=Aspergillus terreus GN=lovA PE=1 SV=1 52 464 6.0E-27
sp|B9WZX6|FTMG_ASPFM Fumitremorgin C monooxygenase OS=Neosartorya fumigata GN=ftmP450-3 PE=1 SV=1 35 497 6.0E-24
sp|A1DA65|FTMG_NEOFI Fumitremorgin C monooxygenase OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=ftmP450-3 PE=3 SV=1 35 463 7.0E-24
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O94142|KO1_GIBFU Ent-kaurene oxidase OS=Gibberella fujikuroi GN=CYP503A1 PE=1 SV=1 32 496 1.0E-72
sp|Q701P2|KO1_GIBIN Ent-kaurene oxidase OS=Gibberella intermedia GN=CYP503A1 PE=1 SV=1 32 496 2.0E-72
sp|Q9Y7C8|LOVA_ASPTE Dihydromonacolin L monooxygenase LovA OS=Aspergillus terreus GN=lovA PE=1 SV=1 52 464 6.0E-27
sp|B9WZX6|FTMG_ASPFM Fumitremorgin C monooxygenase OS=Neosartorya fumigata GN=ftmP450-3 PE=1 SV=1 35 497 6.0E-24
sp|A1DA65|FTMG_NEOFI Fumitremorgin C monooxygenase OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=ftmP450-3 PE=3 SV=1 35 463 7.0E-24
sp|Q4WAX0|FTMG_ASPFU Fumitremorgin C monooxygenase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=ftmP450-3 PE=3 SV=1 35 463 1.0E-23
sp|O46420|CP51A_PIG Lanosterol 14-alpha demethylase OS=Sus scrofa GN=CYP51A1 PE=2 SV=1 242 464 7.0E-16
sp|Q6XQ14|C71E7_MANES 2-methylbutanal oxime monooxygenase OS=Manihot esculenta GN=CYP71E7 PE=1 SV=1 167 496 1.0E-15
sp|Q4PJW3|CP51A_BOVIN Lanosterol 14-alpha demethylase OS=Bos taurus GN=CYP51A1 PE=2 SV=1 242 464 1.0E-15
sp|Q4R8S6|CP51A_MACFA Lanosterol 14-alpha demethylase OS=Macaca fascicularis GN=CYP51A1 PE=2 SV=2 242 464 2.0E-15
sp|Q5RE72|CP51A_PONAB Lanosterol 14-alpha demethylase OS=Pongo abelii GN=CYP51A1 PE=2 SV=2 251 464 2.0E-15
sp|Q16850|CP51A_HUMAN Lanosterol 14-alpha demethylase OS=Homo sapiens GN=CYP51A1 PE=1 SV=3 251 464 7.0E-15
sp|S4UX02|CYPH1_SALMI Ferruginol synthase OS=Salvia miltiorrhiza GN=CYP76AH1 PE=1 SV=1 239 465 1.0E-14
sp|Q02318|CP27A_HUMAN Sterol 26-hydroxylase, mitochondrial OS=Homo sapiens GN=CYP27A1 PE=1 SV=1 292 464 1.0E-14
sp|Q759W0|CP51_ASHGO Lanosterol 14-alpha demethylase OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=ERG11 PE=3 SV=1 249 454 2.0E-14
sp|Q9VMT5|C28D1_DROME Probable cytochrome P450 28d1 OS=Drosophila melanogaster GN=Cyp28d1 PE=2 SV=1 3 464 2.0E-14
sp|P17178|CP27A_RAT Sterol 26-hydroxylase, mitochondrial OS=Rattus norvegicus GN=Cyp27a1 PE=1 SV=1 243 464 2.0E-14
sp|Q64654|CP51A_RAT Lanosterol 14-alpha demethylase OS=Rattus norvegicus GN=Cyp51a1 PE=2 SV=1 242 464 3.0E-14
sp|Q8K0C4|CP51A_MOUSE Lanosterol 14-alpha demethylase OS=Mus musculus GN=Cyp51a1 PE=1 SV=1 242 464 3.0E-14
sp|Q9DBG1|CP27A_MOUSE Sterol 26-hydroxylase, mitochondrial OS=Mus musculus GN=Cyp27a1 PE=1 SV=1 239 464 4.0E-14
sp|Q9UVC3|CP51_CUNEL Lanosterol 14-alpha demethylase OS=Cunninghamella elegans GN=CYP51 PE=3 SV=1 246 466 7.0E-14
sp|Q07973|CP24A_HUMAN 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial OS=Homo sapiens GN=CYP24A1 PE=1 SV=2 292 495 8.0E-14
sp|P10614|CP51_YEAST Lanosterol 14-alpha demethylase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ERG11 PE=1 SV=1 250 496 2.0E-13
sp|Q64441|CP24A_MOUSE 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial OS=Mus musculus GN=Cyp24a1 PE=2 SV=1 250 462 4.0E-13
sp|Q7X7X4|C99A2_ORYSJ Cytochrome P450 99A2 OS=Oryza sativa subsp. japonica GN=CYP99A2 PE=2 SV=2 297 464 5.0E-13
sp|Q09128|CP24A_RAT 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial OS=Rattus norvegicus GN=Cyp24a1 PE=1 SV=1 250 495 1.0E-12
sp|E3W9C4|C71A1_ZINZE Alpha-humulene 10-hydroxylase OS=Zingiber zerumbet GN=CYP71BA1 PE=1 SV=1 294 484 3.0E-12
sp|Q9V5L3|C49A1_DROME Probable cytochrome P450 49a1 OS=Drosophila melanogaster GN=Cyp49a1 PE=2 SV=3 292 462 4.0E-12
sp|Q9AXH9|KAO1_HORVU Ent-kaurenoic acid oxidase 1 OS=Hordeum vulgare GN=KAO1 PE=1 SV=1 298 462 5.0E-12
sp|O65788|C71B2_ARATH Cytochrome P450 71B2 OS=Arabidopsis thaliana GN=CYP71B2 PE=2 SV=2 240 464 9.0E-12
sp|Q1ZXH9|CP51_DICDI Probable lanosterol 14-alpha demethylase OS=Dictyostelium discoideum GN=cyp51 PE=3 SV=1 250 464 1.0E-11
sp|Q9FH76|ABAH3_ARATH Abscisic acid 8'-hydroxylase 3 OS=Arabidopsis thaliana GN=CYP707A3 PE=1 SV=1 244 495 1.0E-11
sp|Q54DT2|C516A_DICDI Probable cytochrome P450 516A1 OS=Dictyostelium discoideum GN=cyp516A1 PE=3 SV=2 232 465 1.0E-11
sp|Q9V419|C28A5_DROME Probable cytochrome P450 28a5 OS=Drosophila melanogaster GN=Cyp28a5 PE=2 SV=1 245 479 1.0E-11
sp|P50859|CP51_CANGA Lanosterol 14-alpha demethylase OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=ERG11 PE=3 SV=1 250 496 2.0E-11
sp|P17177|CP27A_RABIT Sterol 26-hydroxylase, mitochondrial OS=Oryctolagus cuniculus GN=CYP27A1 PE=2 SV=1 292 464 2.0E-11
sp|Q9PVE8|C330_FUNHE Cytochrome P450 3A30 OS=Fundulus heteroclitus GN=cyp3a30 PE=2 SV=2 248 473 2.0E-11
sp|Q7KR10|CCD1D_DROME Probable cytochrome P450 12d1 distal, mitochondrial OS=Drosophila melanogaster GN=Cyp12d1-d PE=2 SV=1 226 469 3.0E-11
sp|O44220|C12B1_DROAC Cytochrome P450 12b1, mitochondrial OS=Drosophila acanthoptera GN=Cyp12b1 PE=2 SV=1 294 477 3.0E-11
sp|Q8AXY5|C356_FUNHE Cytochrome P450 3A56 OS=Fundulus heteroclitus GN=cyp3a56 PE=2 SV=1 248 473 3.0E-11
sp|Q09736|CP51_SCHPO Lanosterol 14-alpha demethylase erg11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=erg11 PE=1 SV=1 250 496 3.0E-11
sp|P82712|CCD1P_DROME Probable cytochrome P450 12d1 proximal, mitochondrial OS=Drosophila melanogaster GN=Cyp12d1-p PE=2 SV=3 226 469 4.0E-11
sp|P10613|CP51_CANAL Lanosterol 14-alpha demethylase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ERG11 PE=3 SV=2 12 495 5.0E-11
sp|Q8VWZ7|C76B6_CATRO Geraniol 8-hydroxylase OS=Catharanthus roseus GN=CYP76B6 PE=1 SV=1 237 466 7.0E-11
sp|C0SJS3|ANGS_PASSA Angelicin synthase (Fragment) OS=Pastinaca sativa GN=CYP71AJ4 PE=1 SV=1 154 464 9.0E-11
sp|P0DKI7|STORR_PAPSO Bifunctional protein STORR OS=Papaver somniferum GN=STORR PE=1 SV=1 171 463 1.0E-10
sp|P14263|CP51_CANTR Lanosterol 14-alpha demethylase OS=Candida tropicalis GN=ERG11 PE=3 SV=2 12 466 1.0E-10
sp|A2Z212|ABAH3_ORYSI Abscisic acid 8'-hydroxylase 3 OS=Oryza sativa subsp. indica GN=CYP707A7 PE=3 SV=1 245 466 1.0E-10
sp|Q9VE00|C12A4_DROME Probable cytochrome P450 12a4, mitochondrial OS=Drosophila melanogaster GN=Cyp12a4 PE=2 SV=2 224 464 1.0E-10
sp|Q949P1|ABAH1_ARATH Abscisic acid 8'-hydroxylase 1 OS=Arabidopsis thaliana GN=CYP707A1 PE=2 SV=1 256 495 1.0E-10
sp|Q0J185|ABAH3_ORYSJ Abscisic acid 8'-hydroxylase 3 OS=Oryza sativa subsp. japonica GN=CYP707A7 PE=2 SV=1 245 466 1.0E-10
sp|Q9V4U9|C6A13_DROME Probable cytochrome P450 6a13 OS=Drosophila melanogaster GN=Cyp6a13 PE=2 SV=1 256 491 1.0E-10
sp|Q6YTF1|C76M8_ORYSJ Oryzalexin D synthase OS=Oryza sativa subsp. japonica GN=CYP76M8 PE=1 SV=1 242 466 1.0E-10
sp|P51663|C11B1_SHEEP Cytochrome P450 11B1, mitochondrial OS=Ovis aries GN=CYP11B1 PE=2 SV=2 292 464 2.0E-10
sp|O18635|C12A2_MUSDO Cytochrome P450 CYP12A2 OS=Musca domestica GN=CYP12A2 PE=2 SV=1 294 464 2.0E-10
sp|Q9VMT6|C28D2_DROME Probable cytochrome P450 28d2 OS=Drosophila melanogaster GN=Cyp28d2 PE=3 SV=1 25 465 2.0E-10
sp|P22680|CP7A1_HUMAN Cholesterol 7-alpha-monooxygenase OS=Homo sapiens GN=CYP7A1 PE=1 SV=2 1 474 3.0E-10
sp|Q54NY3|C554A_DICDI Probable cytochrome P450 554A1 OS=Dictyostelium discoideum GN=cyp554A1 PE=3 SV=1 250 494 3.0E-10
sp|Q7XU38|C87A3_ORYSJ Cytochrome P450 87A3 OS=Oryza sativa subsp. japonica GN=CYP87A3 PE=2 SV=3 244 476 3.0E-10
sp|O42563|CP3AR_ONCMY Cytochrome P450 3A27 OS=Oncorhynchus mykiss GN=cyp3a27 PE=2 SV=1 249 460 3.0E-10
sp|Q29552|C11B1_PIG Cytochrome P450 11B1, mitochondrial OS=Sus scrofa GN=CYP11B1 PE=2 SV=1 292 464 4.0E-10
sp|Q6QNI4|C71AJ_AMMMJ Psoralen synthase OS=Ammi majus GN=CYP71AJ1 PE=1 SV=1 261 464 4.0E-10
sp|P15150|C11B1_BOVIN Cytochrome P450 11B1, mitochondrial OS=Bos taurus GN=CYP11B1 PE=1 SV=2 292 464 4.0E-10
sp|P20815|CP3A5_HUMAN Cytochrome P450 3A5 OS=Homo sapiens GN=CYP3A5 PE=1 SV=1 258 497 5.0E-10
sp|Q5IZM4|CP51_MYCVP Lanosterol 14-alpha demethylase OS=Mycobacterium vanbaalenii (strain DSM 7251 / PYR-1) GN=cyp51 PE=3 SV=1 245 495 5.0E-10
sp|P15393|C11B1_RAT Cytochrome P450 11B1, mitochondrial OS=Rattus norvegicus GN=Cyp11b1 PE=1 SV=1 297 445 7.0E-10
sp|Q09653|C13AA_CAEEL Putative cytochrome P450 CYP13A10 OS=Caenorhabditis elegans GN=cyp-13A10 PE=3 SV=3 255 464 7.0E-10
sp|P24463|CP3AC_CANLF Cytochrome P450 3A12 OS=Canis lupus familiaris GN=CYP3A12 PE=2 SV=1 248 497 8.0E-10
sp|O81974|C71D8_SOYBN Cytochrome P450 71D8 OS=Glycine max GN=CYP71D8 PE=2 SV=1 150 464 8.0E-10
sp|D5JBW9|GAO_SAUCO Germacrene A oxidase OS=Saussurea costus PE=1 SV=1 168 472 8.0E-10
sp|Q9C5Y2|KAO2_ARATH Ent-kaurenoic acid oxidase 2 OS=Arabidopsis thaliana GN=KAO2 PE=2 SV=2 298 475 9.0E-10
sp|Q69X58|C76M7_ORYSJ Ent-cassadiene C11-alpha-hydroxylase 1 OS=Oryza sativa subsp. japonica GN=CYP76M7 PE=1 SV=1 242 466 9.0E-10
sp|Q9V8M2|C12B2_DROME Probable cytochrome P450 12b2, mitochondrial OS=Drosophila melanogaster GN=Cyp12b2 PE=2 SV=2 294 462 1.0E-09
sp|O48923|C71DA_SOYBN Cytochrome P450 71D10 OS=Glycine max GN=CYP71D10 PE=2 SV=1 242 496 1.0E-09
sp|F2Z9C1|P6H_ESCCA Protopine 6-monooxygenase OS=Eschscholzia californica GN=CYP82N2v2 PE=1 SV=1 249 474 1.0E-09
sp|P58048|C71B8_ARATH Cytochrome P450 71B8 OS=Arabidopsis thaliana GN=CYP71B8 PE=3 SV=1 192 464 1.0E-09
sp|O81970|C71A9_SOYBN Cytochrome P450 71A9 OS=Glycine max GN=CYP71A9 PE=2 SV=1 163 464 1.0E-09
sp|O93323|CP26A_XENLA Cytochrome P450 26A1 OS=Xenopus laevis GN=cyp26a1 PE=2 SV=1 105 464 1.0E-09
sp|Q9LVD2|C71BA_ARATH Cytochrome P450 71B10 OS=Arabidopsis thaliana GN=CYP71B10 PE=3 SV=1 93 464 1.0E-09
sp|Q9HB55|CP343_HUMAN Cytochrome P450 3A43 OS=Homo sapiens GN=CYP3A43 PE=1 SV=1 242 463 1.0E-09
sp|P05183|CP3A2_RAT Cytochrome P450 3A2 OS=Rattus norvegicus GN=Cyp3a2 PE=1 SV=2 239 463 1.0E-09
sp|Q9LTM3|C71BK_ARATH Cytochrome P450 71B20 OS=Arabidopsis thaliana GN=CYP71B20 PE=2 SV=1 201 471 2.0E-09
sp|F8S1I0|C7BL2_LACSA Costunolide synthase OS=Lactuca sativa GN=CYP71BL2 PE=1 SV=1 160 479 2.0E-09
sp|Q9LSF8|C82G1_ARATH Cytochrome P450 82G1 OS=Arabidopsis thaliana GN=CYP82G1 PE=1 SV=1 284 462 2.0E-09
sp|D5J9U8|GAO_LACSA Germacrene A oxidase OS=Lactuca sativa GN=GAO1 PE=1 SV=1 153 472 2.0E-09
sp|P08684|CP3A4_HUMAN Cytochrome P450 3A4 OS=Homo sapiens GN=CYP3A4 PE=1 SV=4 242 497 2.0E-09
sp|O48928|C77A3_SOYBN Cytochrome P450 77A3 OS=Glycine max GN=CYP77A3 PE=2 SV=1 299 461 2.0E-09
sp|Q8N118|CP4X1_HUMAN Cytochrome P450 4X1 OS=Homo sapiens GN=CYP4X1 PE=2 SV=1 261 460 3.0E-09
sp|Q9LW27|C71BF_ARATH Bifunctional dihydrocamalexate synthase/camalexin synthase OS=Arabidopsis thaliana GN=CYP71B15 PE=1 SV=1 171 481 3.0E-09
sp|P28649|CP19A_MOUSE Aromatase OS=Mus musculus GN=Cyp19a1 PE=2 SV=1 134 463 3.0E-09
sp|P37124|C77A2_SOLME Cytochrome P450 77A2 OS=Solanum melongena GN=CYP77A2 PE=2 SV=1 299 461 3.0E-09
sp|D5JBW8|GAO_CICIN Germacrene A oxidase OS=Cichorium intybus PE=1 SV=1 170 472 3.0E-09
sp|O23051|KAO1_ARATH Ent-kaurenoic acid oxidase 1 OS=Arabidopsis thaliana GN=KAO1 PE=2 SV=1 298 463 4.0E-09
sp|Q9FH66|C71AG_ARATH Cytochrome P450 71A16 OS=Arabidopsis thaliana GN=CYP71A16 PE=2 SV=1 227 482 4.0E-09
sp|Q6A152|CP4X1_MOUSE Cytochrome P450 4X1 OS=Mus musculus GN=Cyp4x1 PE=1 SV=1 241 494 4.0E-09
sp|Q64459|CP3AB_MOUSE Cytochrome P450 3A11 OS=Mus musculus GN=Cyp3a11 PE=1 SV=1 248 490 4.0E-09
sp|Q9SAA9|CP511_ARATH Sterol 14-demethylase OS=Arabidopsis thaliana GN=CYP51G1 PE=1 SV=1 263 464 4.0E-09
sp|Q54QD2|C5171_DICDI Probable cytochrome P450 517A1 OS=Dictyostelium discoideum GN=cyp517A1 PE=2 SV=1 255 466 4.0E-09
sp|Q09660|CC44_CAEEL Probable cytochrome P450 CYP44 OS=Caenorhabditis elegans GN=cyp-44A1 PE=3 SV=2 242 466 4.0E-09
sp|Q9VFP1|CP6D5_DROME Probable cytochrome P450 6d5 OS=Drosophila melanogaster GN=Cyp6d5 PE=2 SV=1 268 465 5.0E-09
sp|P08516|CP4AA_RAT Cytochrome P450 4A10 OS=Rattus norvegicus GN=Cyp4a10 PE=1 SV=2 205 462 5.0E-09
sp|Q27756|CP6B3_PAPPO Cytochrome P450 6B3 OS=Papilio polyxenes GN=CYP6B3 PE=2 SV=1 267 460 5.0E-09
sp|Q9T0K2|C71AK_ARATH Cytochrome P450 71A20 OS=Arabidopsis thaliana GN=CYP71A20 PE=2 SV=2 155 464 6.0E-09
sp|L7X0L7|P6H_PAPSO Protopine 6-monooxygenase OS=Papaver somniferum GN=CYP82N3 PE=2 SV=1 242 463 7.0E-09
sp|P15539|C11B2_MOUSE Cytochrome P450 11B2, mitochondrial OS=Mus musculus GN=Cyp11b2 PE=2 SV=3 292 463 7.0E-09
sp|Q9LTM6|C71BH_ARATH Cytochrome P450 71B17 OS=Arabidopsis thaliana GN=CYP71B17 PE=3 SV=1 204 471 8.0E-09
sp|A6YIH8|C7D55_HYOMU Premnaspirodiene oxygenase OS=Hyoscyamus muticus GN=CYP71D55 PE=1 SV=1 161 464 8.0E-09
sp|O04164|C71A6_NEPRA Cytochrome P450 71A6 (Fragment) OS=Nepeta racemosa GN=CYP71A6 PE=2 SV=1 165 464 8.0E-09
sp|Q54QD0|C5174_DICDI Probable cytochrome P450 517A4 OS=Dictyostelium discoideum GN=cyp517A4 PE=3 SV=1 255 466 8.0E-09
sp|Q27518|C13A2_CAEEL Putative cytochrome P450 CYP13A2 OS=Caenorhabditis elegans GN=cyp-13A2 PE=3 SV=1 255 495 9.0E-09
sp|P93596|CP51_WHEAT Obtusifoliol 14-alpha demethylase (Fragment) OS=Triticum aestivum GN=CYP51 PE=2 SV=1 250 464 1.0E-08
sp|Q42716|C71A8_MENPI Cytochrome P450 71A8 OS=Mentha piperita GN=CYP71A8 PE=3 SV=1 250 464 1.0E-08
sp|Q9GJX5|CP4AL_PIG Taurochenodeoxycholic 6 alpha-hydroxylase OS=Sus scrofa GN=CYP4A21 PE=1 SV=1 260 462 1.0E-08
sp|Q43246|C88A1_MAIZE Cytochrome P450 88A1 OS=Zea mays GN=CYP88A1 PE=2 SV=1 298 462 1.0E-08
sp|Q98T91|C340_ORYLA Cytochrome P450 3A40 OS=Oryzias latipes GN=cyp3a40 PE=2 SV=1 264 473 1.0E-08
sp|Q09J78|ABAH2_ORYSI Abscisic acid 8'-hydroxylase 2 OS=Oryza sativa subsp. indica GN=CYP707A6 PE=2 SV=1 282 466 1.0E-08
sp|Q6ZDE3|ABAH2_ORYSJ Abscisic acid 8'-hydroxylase 2 OS=Oryza sativa subsp. japonica GN=CYP707A6 PE=2 SV=1 282 466 1.0E-08
sp|D1MI46|C76BA_SWEMU Geraniol 8-hydroxylase OS=Swertia mussotii GN=CYP76B10 PE=1 SV=1 245 466 1.0E-08
sp|Q92087|CP19A_ORYLA Aromatase OS=Oryzias latipes GN=cyp19a1 PE=2 SV=1 134 462 1.0E-08
sp|Q9JMA7|CP341_MOUSE Cytochrome P450 3A41 OS=Mus musculus GN=Cyp3a41a PE=1 SV=2 248 463 1.0E-08
sp|P49602|CP51_USTMA Lanosterol 14-alpha demethylase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=ERG11 PE=3 SV=1 284 497 1.0E-08
sp|P49264|C71B1_THLAR Cytochrome P450 71B1 OS=Thlaspi arvense GN=CYP71B1 PE=2 SV=1 161 464 1.0E-08
sp|P37123|C77A1_SOLME Cytochrome P450 77A1 (Fragment) OS=Solanum melongena GN=CYP77A1 PE=2 SV=1 299 461 2.0E-08
sp|C0SJS2|C71AJ_PASSA Psoralen synthase (Fragment) OS=Pastinaca sativa GN=CYP71AJ3 PE=1 SV=1 271 464 2.0E-08
sp|Q9LTM7|C71BG_ARATH Cytochrome P450 71B16 OS=Arabidopsis thaliana GN=CYP71B16 PE=3 SV=1 240 471 2.0E-08
sp|Q12664|CP51_PENIT Eburicol 14-alpha-demethylase OS=Penicillium italicum GN=CYP51 PE=3 SV=1 258 460 2.0E-08
sp|P30100|C11B3_RAT Cytochrome P450 11B3, mitochondrial OS=Rattus norvegicus GN=Cyp11b3 PE=1 SV=1 292 445 2.0E-08
sp|P30099|C11B2_RAT Cytochrome P450 11B2, mitochondrial OS=Rattus norvegicus GN=Cyp11b2 PE=1 SV=1 292 445 2.0E-08
sp|Q6Z5I7|C76M6_ORYSJ Oryzalexin E synthase OS=Oryza sativa subsp. japonica GN=CYP76M6 PE=1 SV=1 238 464 2.0E-08
sp|Q12645|PID9_FUSSO Pisatin demethylase OS=Fusarium solani subsp. pisi GN=PDAT9 PE=3 SV=1 299 468 2.0E-08
sp|P48421|C83A1_ARATH Cytochrome P450 83A1 OS=Arabidopsis thaliana GN=CYP83A1 PE=1 SV=2 238 464 2.0E-08
sp|P98183|C71DC_CATRO Tabersonine 16-hydroxylase (Fragment) OS=Catharanthus roseus GN=CYP71D12 PE=1 SV=1 248 461 2.0E-08
sp|Q9LTM4|C71BJ_ARATH Cytochrome P450 71B19 OS=Arabidopsis thaliana GN=CYP71B19 PE=2 SV=1 201 471 2.0E-08
sp|O35728|CP4AE_MOUSE Cytochrome P450 4A14 OS=Mus musculus GN=Cyp4a14 PE=1 SV=1 205 462 2.0E-08
sp|P22443|CP19A_RAT Aromatase OS=Rattus norvegicus GN=Cyp19a1 PE=2 SV=1 134 475 3.0E-08
sp|Q59990|CP120_SYNY3 Putative cytochrome P450 120 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=cyp120 PE=1 SV=1 162 464 3.0E-08
sp|O48958|C71E1_SORBI 4-hydroxyphenylacetaldehyde oxime monooxygenase OS=Sorghum bicolor GN=CYP71E1 PE=2 SV=1 255 466 3.0E-08
sp|L7X3S1|MSH_PAPSO Methyltetrahydroprotoberberine 14-monooxygenase OS=Papaver somniferum GN=CYP82N4 PE=1 SV=1 252 462 3.0E-08
sp|O64718|C71B9_ARATH Cytochrome P450 71B9 OS=Arabidopsis thaliana GN=CYP71B9 PE=2 SV=3 93 464 3.0E-08
sp|Q5TCH4|CP4AM_HUMAN Cytochrome P450 4A22 OS=Homo sapiens GN=CYP4A22 PE=1 SV=1 205 462 3.0E-08
sp|Q93ZB2|KO1_ARATH Ent-kaurene oxidase, chloroplastic OS=Arabidopsis thaliana GN=KO PE=1 SV=2 238 465 3.0E-08
sp|O18993|CP3AL_CALJA Cytochrome P450 3A21 OS=Callithrix jacchus GN=CYP3A21 PE=2 SV=1 250 463 3.0E-08
sp|O17624|C13B1_CAEEL Putative cytochrome P450 cyp-13B1 OS=Caenorhabditis elegans GN=cyp-13B1 PE=3 SV=2 291 462 3.0E-08
sp|P93846|CP51_SORBI Obtusifoliol 14-alpha demethylase OS=Sorghum bicolor GN=CYP51 PE=1 SV=1 250 464 3.0E-08
sp|Q43255|C71C2_MAIZE indolin-2-one monooxygenase OS=Zea mays GN=CYP71C2 PE=1 SV=1 245 469 3.0E-08
sp|Q27515|C13A6_CAEEL Putative cytochrome P450 CYP13A6 OS=Caenorhabditis elegans GN=cyp-13A6 PE=3 SV=1 299 463 3.0E-08
sp|Q964R1|CP6J1_BLAGE Cytochrome P450 6j1 OS=Blattella germanica GN=CYP6J1 PE=2 SV=1 260 462 4.0E-08
sp|O81973|C93A3_SOYBN Cytochrome P450 93A3 OS=Glycine max GN=CYP93A3 PE=2 SV=1 264 464 4.0E-08
sp|Q64408|C11B1_CAVPO Cytochrome P450 11B1, mitochondrial OS=Cavia porcellus GN=CYP11B1 PE=2 SV=1 297 464 4.0E-08
sp|Q8SPK1|CP4AO_PIG Cytochrome P450 4A24 OS=Sus scrofa GN=CYP4A24 PE=2 SV=1 233 462 4.0E-08
sp|O70537|CP3AV_MESAU Cytochrome P450 3A31 OS=Mesocricetus auratus GN=CYP3A31 PE=2 SV=1 244 463 5.0E-08
sp|Q96514|C71B7_ARATH Cytochrome P450 71B7 OS=Arabidopsis thaliana GN=CYP71B7 PE=1 SV=1 212 461 5.0E-08
sp|Q9LZ31|C77A4_ARATH Cytochrome P450 77A4 OS=Arabidopsis thaliana GN=CYP77A4 PE=2 SV=1 236 470 5.0E-08
sp|Q9T0K0|C71AJ_ARATH Cytochrome P450 71A19 OS=Arabidopsis thaliana GN=CYP71A19 PE=2 SV=1 308 464 5.0E-08
sp|Q8SPK0|CP4AP_PIG Cytochrome P450 4A25 OS=Sus scrofa GN=CYP4A25 PE=2 SV=1 233 462 5.0E-08
sp|Q9LNJ4|C70A2_ARATH Cytochrome P450 703A2 OS=Arabidopsis thaliana GN=CYP703A2 PE=2 SV=1 251 467 5.0E-08
sp|P24465|C71A1_PERAE Cytochrome P450 71A1 OS=Persea americana GN=CYP71A1 PE=1 SV=2 240 466 5.0E-08
sp|Q9LTL2|C71BP_ARATH Cytochrome P450 71B25 OS=Arabidopsis thaliana GN=CYP71B25 PE=2 SV=1 168 464 6.0E-08
sp|Q02928|CP4AB_HUMAN Cytochrome P450 4A11 OS=Homo sapiens GN=CYP4A11 PE=1 SV=1 200 462 6.0E-08
sp|O42145|C19AA_DANRE Aromatase OS=Danio rerio GN=cyp19a1a PE=2 SV=1 134 462 6.0E-08
sp|D5JBX0|GAO_HELAN Germacrene A oxidase OS=Helianthus annuus PE=1 SV=1 310 472 6.0E-08
sp|Q9VGZ0|C12E1_DROME Probable cytochrome P450 12e1, mitochondrial OS=Drosophila melanogaster GN=Cyp12e1 PE=2 SV=4 292 462 7.0E-08
sp|P79739|CP26A_DANRE Cytochrome P450 26A1 OS=Danio rerio GN=cyp26a1 PE=2 SV=1 135 484 7.0E-08
sp|Q9SAE3|C71BS_ARATH Cytochrome P450 71B28 OS=Arabidopsis thaliana GN=CYP71B28 PE=2 SV=1 222 482 7.0E-08
sp|Q9STL1|C71AM_ARATH Cytochrome P450 71A22 OS=Arabidopsis thaliana GN=CYP71A22 PE=2 SV=1 308 464 7.0E-08
sp|Q9XHE8|C71DI_MENSP Cytochrome P450 71D18 OS=Mentha spicata GN=CYP71D18 PE=1 SV=1 295 464 8.0E-08
sp|Q6WKZ1|C71DI_MENGR Cytochrome P450 71D18 OS=Mentha gracilis GN=CYP71D18 PE=1 SV=1 295 464 8.0E-08
sp|C0SJS4|C71AJ_APIGR Psoralen synthase (Fragment) OS=Apium graveolens GN=CYP71AJ2 PE=1 SV=1 154 464 8.0E-08
sp|Q9LJY7|C75AK_ARATH Cytochrome P450 705A20 OS=Arabidopsis thaliana GN=CYP705A20 PE=2 SV=1 245 466 8.0E-08
sp|H2DH24|C7D47_PANGI Cytochrome P450 CYP82D47 OS=Panax ginseng PE=2 SV=1 171 457 8.0E-08
sp|Q93VK5|LUT5_ARATH Protein LUTEIN DEFICIENT 5, chloroplastic OS=Arabidopsis thaliana GN=CYP97A3 PE=1 SV=1 298 464 8.0E-08
sp|Q9VE01|C12A5_DROME Probable cytochrome P450 12a5, mitochondrial OS=Drosophila melanogaster GN=Cyp12a5 PE=2 SV=1 223 464 9.0E-08
sp|Q9V6D6|CP301_DROME Probable cytochrome P450 301a1, mitochondrial OS=Drosophila melanogaster GN=Cyp301a1 PE=2 SV=1 292 463 9.0E-08
sp|Q43147|C85A1_SOLLC Cytochrome P450 85A1 OS=Solanum lycopersicum GN=CYP85A1 PE=2 SV=1 242 460 9.0E-08
sp|Q04552|CP6B1_PAPPO Cytochrome P450 6B1 OS=Papilio polyxenes GN=CYP6B1 PE=1 SV=1 291 460 1.0E-07
sp|Q29527|C11B1_PAPHU Cytochrome P450 11B1, mitochondrial OS=Papio hamadryas ursinus GN=CYP11B1 PE=3 SV=1 278 442 1.0E-07
sp|P33268|CP3A8_MACFA Cytochrome P450 3A8 OS=Macaca fascicularis GN=CYP3A8 PE=1 SV=1 242 463 1.0E-07
sp|O08336|CYPB_BACSU Bifunctional cytochrome P450/NADPH--P450 reductase 2 OS=Bacillus subtilis (strain 168) GN=cypB PE=1 SV=1 208 462 1.0E-07
sp|Q9FG65|C81D1_ARATH Cytochrome P450 81D1 OS=Arabidopsis thaliana GN=CYP81D1 PE=2 SV=1 254 467 1.0E-07
sp|G3GBK0|C7BL3_CICIN Costunolide synthase OS=Cichorium intybus GN=CYP71BL3 PE=1 SV=1 160 479 1.0E-07
sp|P19099|C11B2_HUMAN Cytochrome P450 11B2, mitochondrial OS=Homo sapiens GN=CYP11B2 PE=1 SV=3 292 442 1.0E-07
sp|D5JBX1|GAO_BARSP Germacrene A oxidase OS=Barnadesia spinosa PE=1 SV=1 310 464 1.0E-07
sp|Q43250|C71C1_MAIZE 3-hydroxyindolin-2-one monooxygenase OS=Zea mays GN=CYP71C1 PE=1 SV=1 295 464 2.0E-07
sp|P04800|CP3A1_RAT Cytochrome P450 3A1 OS=Rattus norvegicus GN=Cyp3a1 PE=1 SV=1 260 463 2.0E-07
sp|B6SSW8|C14B3_MAIZE Cytochrome P450 714B3 OS=Zea mays GN=CYP714B3 PE=2 SV=1 299 470 2.0E-07
sp|F8S1H3|C7BL1_HELAN Cytochrome P450 71BL1 OS=Helianthus annuus GN=CYP71BL1 PE=2 SV=1 160 484 2.0E-07
sp|Q501D8|C79B3_ARATH Tryptophan N-monooxygenase 2 OS=Arabidopsis thaliana GN=CYP79B3 PE=1 SV=1 275 466 2.0E-07
sp|Q27902|CP6B4_PAPGL Cytochrome P450 6B4 OS=Papilio glaucus GN=CYP6B4 PE=2 SV=1 284 460 2.0E-07
sp|Q95036|CP6B5_PAPGL Cytochrome P450 6B5 (Fragment) OS=Papilio glaucus GN=CYP6B5 PE=2 SV=1 176 460 2.0E-07
sp|Q0DS59|C14B2_ORYSJ Cytochrome P450 714B2 OS=Oryza sativa subsp. japonica GN=CYP714B2 PE=1 SV=2 292 470 2.0E-07
sp|E1B2Z9|C7AV8_CICIN Cytochrome P450 71AV8 OS=Cichorium intybus GN=CYP71AV8 PE=2 SV=1 310 464 2.0E-07
sp|O22307|C71DB_LOTJA Cytochrome P450 71D11 (Fragment) OS=Lotus japonicus GN=CYP71D11 PE=2 SV=1 294 464 2.0E-07
sp|Q92104|CP11B_LITCT Cytochrome P450 11B, mitochondrial OS=Lithobates catesbeiana GN=CYP11B PE=2 SV=1 297 462 2.0E-07
sp|O14442|CP51_UNCNE Eburicol 14-alpha-demethylase OS=Uncinula necator GN=CYP51 PE=2 SV=2 249 457 2.0E-07
sp|Q94FM7|C71DK_TOBAC 5-epiaristolochene 1,3-dihydroxylase OS=Nicotiana tabacum GN=CYP71D20 PE=1 SV=2 295 464 2.0E-07
sp|P11511|CP19A_HUMAN Aromatase OS=Homo sapiens GN=CYP19A1 PE=1 SV=3 134 467 3.0E-07
sp|Q9PUB4|CP26A_CHICK Cytochrome P450 26A1 OS=Gallus gallus GN=CYP26A1 PE=2 SV=1 248 484 3.0E-07
sp|Q9V4I1|CP9B2_DROME Cytochrome P450 9b2 OS=Drosophila melanogaster GN=Cyp9b2 PE=2 SV=1 217 463 3.0E-07
sp|P24462|CP3A7_HUMAN Cytochrome P450 3A7 OS=Homo sapiens GN=CYP3A7 PE=1 SV=2 249 463 3.0E-07
sp|P15538|C11B1_HUMAN Cytochrome P450 11B1, mitochondrial OS=Homo sapiens GN=CYP11B1 PE=1 SV=5 278 442 3.0E-07
sp|Q8L7D5|THAH_ARATH Cytochrome P450 708A2 OS=Arabidopsis thaliana GN=CYP708A2 PE=2 SV=3 211 474 3.0E-07
sp|B5BSX1|BAMO_GLYUR Beta-amyrin 11-oxidase OS=Glycyrrhiza uralensis GN=CYP88D6 PE=1 SV=1 280 463 3.0E-07
sp|Q27517|C13A3_CAEEL Putative cytochrome P450 CYP13A3 OS=Caenorhabditis elegans GN=cyp-13A3 PE=3 SV=1 220 463 3.0E-07
sp|Q9VLZ7|C4D21_DROME Probable cytochrome P450 4d21 OS=Drosophila melanogaster GN=Cyp4d21 PE=3 SV=1 299 462 4.0E-07
sp|Q86W10|CP4Z1_HUMAN Cytochrome P450 4Z1 OS=Homo sapiens GN=CYP4Z1 PE=2 SV=1 194 497 4.0E-07
sp|Q6YTF5|C76M5_ORYSJ Cytochrome P450 76M5 OS=Oryza sativa subsp. japonica GN=CYP76M5 PE=1 SV=1 250 464 4.0E-07
sp|Q29496|CP3AO_SHEEP Cytochrome P450 3A24 OS=Ovis aries GN=CYP3A24 PE=2 SV=1 250 463 4.0E-07
sp|Q8K4D6|CP4X1_RAT Cytochrome P450 4X1 OS=Rattus norvegicus GN=Cyp4x1 PE=2 SV=1 294 494 4.0E-07
sp|Q1PS23|AMO_ARTAN Amorpha-4,11-diene 12-monooxygenase OS=Artemisia annua GN=CYP71AV1 PE=1 SV=1 291 496 4.0E-07
sp|P37118|C71A2_SOLME Cytochrome P450 71A2 OS=Solanum melongena GN=CYP71A2 PE=2 SV=1 157 464 4.0E-07
sp|Q5UQI3|CP51_MIMIV Probable lanosterol 14-alpha demethylase OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L808 PE=3 SV=1 173 461 4.0E-07
sp|O65787|C71B6_ARATH Cytochrome P450 71B6 OS=Arabidopsis thaliana GN=CYP71B6 PE=2 SV=1 174 481 4.0E-07
sp|Q9NGX9|CP302_DROME Cytochrome P450 302a1, mitochondrial OS=Drosophila melanogaster GN=dib PE=2 SV=2 288 445 4.0E-07
sp|Q7Y1V5|C78AB_ORYSJ Cytochrome P450 78A11 OS=Oryza sativa subsp. japonica GN=CYP78A11 PE=1 SV=2 240 464 5.0E-07
sp|P14779|CPXB_BACME Bifunctional cytochrome P450/NADPH--P450 reductase OS=Bacillus megaterium GN=cyp102A1 PE=1 SV=2 234 463 5.0E-07
sp|Q947B7|MFS_MENPI (+)-menthofuran synthase OS=Mentha piperita PE=1 SV=1 252 468 5.0E-07
sp|O35132|CP27B_RAT 25-hydroxyvitamin D-1 alpha hydroxylase, mitochondrial OS=Rattus norvegicus GN=Cyp27b1 PE=2 SV=2 292 462 5.0E-07
sp|P38364|PID6_FUSSO Pisatin demethylase OS=Fusarium solani subsp. pisi GN=PDA6-1 PE=3 SV=1 243 468 5.0E-07
sp|Q29605|CP19A_RABIT Aromatase OS=Oryctolagus cuniculus GN=CYP19A1 PE=2 SV=1 251 466 5.0E-07
sp|O46512|CP19A_HORSE Aromatase OS=Equus caballus GN=CYP19A1 PE=2 SV=1 249 467 5.0E-07
sp|P48416|CP10_LYMST Cytochrome P450 10 OS=Lymnaea stagnalis GN=CYP10 PE=2 SV=1 292 462 5.0E-07
sp|Q9VQD2|CP391_DROME Probable cytochrome P450 309a1 OS=Drosophila melanogaster GN=Cyp309a1 PE=1 SV=4 195 463 5.0E-07
sp|H2DH22|C7A10_PANGI Cytochrome P450 CYP73A100 OS=Panax ginseng PE=2 SV=1 249 468 6.0E-07
sp|Q27516|C13A8_CAEEL Putative cytochrome P450 CYP13A8 OS=Caenorhabditis elegans GN=cyp-13A8 PE=3 SV=2 291 460 6.0E-07
sp|Q9SAE4|C71BT_ARATH Cytochrome P450 71B29 OS=Arabidopsis thaliana GN=CYP71B29 PE=3 SV=1 294 482 6.0E-07
sp|Q964T2|CP9E2_BLAGE Cytochrome P450 9e2 OS=Blattella germanica GN=CYP9E2 PE=2 SV=1 303 464 7.0E-07
sp|Q9SZ46|C82C4_ARATH Cytochrome P450 82C4 OS=Arabidopsis thaliana GN=CYP82C4 PE=2 SV=1 156 463 7.0E-07
sp|O23976|C76B1_HELTU 7-ethoxycoumarin O-deethylase OS=Helianthus tuberosus GN=CYP76B1 PE=1 SV=1 241 464 8.0E-07
sp|P00189|CP11A_BOVIN Cholesterol side-chain cleavage enzyme, mitochondrial OS=Bos taurus GN=CYP11A1 PE=1 SV=1 297 496 8.0E-07
sp|Q54CS3|C508C_DICDI Probable cytochrome P450 508C1 OS=Dictyostelium discoideum GN=cyp508C1 PE=3 SV=1 242 494 9.0E-07
sp|Q0JF01|C99A3_ORYSJ 9-beta-pimara-7,15-diene oxidase OS=Oryza sativa subsp. japonica GN=CYP99A3 PE=1 SV=1 307 464 9.0E-07
sp|O65438|C71AR_ARATH Cytochrome P450 71A27 OS=Arabidopsis thaliana GN=CYP71A27 PE=3 SV=3 299 465 9.0E-07
sp|Q27519|C13A7_CAEEL Putative cytochrome P450 CYP13A7 OS=Caenorhabditis elegans GN=cyp-13A7 PE=3 SV=1 289 460 9.0E-07
sp|P51542|CP7A1_RABIT Cholesterol 7-alpha-monooxygenase OS=Oryctolagus cuniculus GN=CYP7A1 PE=1 SV=1 300 474 9.0E-07
sp|O88833|CP4AA_MOUSE Cytochrome P450 4A10 OS=Mus musculus GN=Cyp4a10 PE=2 SV=2 205 462 1.0E-06
sp|Q6QHT9|CP19A_ANGJA Aromatase OS=Anguilla japonica GN=cyp19a1 PE=2 SV=1 251 462 1.0E-06
sp|O75881|CP7B1_HUMAN 25-hydroxycholesterol 7-alpha-hydroxylase OS=Homo sapiens GN=CYP7B1 PE=1 SV=2 284 464 1.0E-06
sp|Q9FIB0|C78A7_ARATH Cytochrome P450 78A7 OS=Arabidopsis thaliana GN=CYP78A7 PE=2 SV=1 188 461 1.0E-06
sp|Q43257|C71C4_MAIZE indole-2-monooxygenase OS=Zea mays GN=CYP71C4 PE=1 SV=1 299 464 1.0E-06
sp|O16805|CP4D1_DROSI Cytochrome P450 4d1 OS=Drosophila simulans GN=Cyp4d1 PE=3 SV=1 299 494 1.0E-06
sp|Q05JG2|ABAH1_ORYSJ Abscisic acid 8'-hydroxylase 1 OS=Oryza sativa subsp. japonica GN=CYP707A5 PE=2 SV=1 255 460 1.0E-06
sp|Q09J79|ABAH1_ORYSI Abscisic acid 8'-hydroxylase 1 OS=Oryza sativa subsp. indica GN=CYP707A5 PE=2 SV=1 255 460 1.0E-06
sp|O81345|C79B1_SINAL Cytochrome P450 79B1 OS=Sinapis alba GN=CYP79B1 PE=2 SV=1 275 464 1.0E-06
sp|P51871|CP4F6_RAT Cytochrome P450 4F6 OS=Rattus norvegicus GN=Cyp4f6 PE=2 SV=1 299 460 1.0E-06
sp|Q9XHE6|C71DF_MENPI Cytochrome P450 71D15 OS=Mentha piperita GN=CYP71D15 PE=1 SV=1 295 464 1.0E-06
sp|Q82IY3|PTLI_STRAW Pentalenene oxygenase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=ptlI PE=1 SV=1 167 465 1.0E-06
sp|P15128|CP4B1_RABIT Cytochrome P450 4B1 OS=Oryctolagus cuniculus GN=CYP4B1 PE=1 SV=1 243 464 1.0E-06
sp|Q6J541|C79D3_LOTJA Isoleucine N-monooxygenase 1 OS=Lotus japonicus GN=CYP79D3 PE=1 SV=1 292 493 1.0E-06
sp|Q95M61|CP19A_CALJA Aromatase OS=Callithrix jacchus GN=CYP19A1 PE=2 SV=2 242 466 1.0E-06
sp|Q9ZU07|C71BC_ARATH Cytochrome P450 71B12 OS=Arabidopsis thaliana GN=CYP71B12 PE=2 SV=1 288 464 1.0E-06
sp|F4JW83|C84A4_ARATH Cytochrome P450 84A4 OS=Arabidopsis thaliana GN=CYP84A4 PE=1 SV=1 192 457 1.0E-06
sp|Q64464|CP3AD_MOUSE Cytochrome P450 3A13 OS=Mus musculus GN=Cyp3a13 PE=1 SV=1 248 463 1.0E-06
sp|Q27514|C13A5_CAEEL Putative cytochrome P450 CYP13A5 OS=Caenorhabditis elegans GN=cyp-13A5 PE=3 SV=1 289 460 2.0E-06
sp|P79153|CP11A_CAPHI Cholesterol side-chain cleavage enzyme, mitochondrial OS=Capra hircus GN=CYP11A1 PE=2 SV=1 297 496 2.0E-06
sp|Q9XS28|CP19A_SHEEP Aromatase OS=Ovis aries GN=CYP19A1 PE=2 SV=1 249 466 2.0E-06
sp|Q6YI21|CP19A_CAPHI Aromatase OS=Capra hircus GN=CYP19A1 PE=2 SV=1 249 466 2.0E-06
sp|O46491|CP7A1_PIG Cholesterol 7-alpha-monooxygenase OS=Sus scrofa GN=CYP7A1 PE=3 SV=1 299 474 2.0E-06
sp|P93147|C81E1_GLYEC Isoflavone 2'-hydroxylase OS=Glycyrrhiza echinata GN=CYP81E1 PE=1 SV=2 244 493 2.0E-06
sp|Q9STL2|C71AL_ARATH Cytochrome P450 71A21 OS=Arabidopsis thaliana GN=CYP71A21 PE=2 SV=1 310 464 2.0E-06
sp|B9G934|C14C3_ORYSJ Cytochrome P450 714C3 OS=Oryza sativa subsp. japonica GN=CYP714C3 PE=3 SV=2 171 460 2.0E-06
sp|Q9SP06|C80B3_PAPSO (S)-N-methylcoclaurine 3'-hydroxylase isozyme 1 (Fragment) OS=Papaver somniferum GN=CYP80B3 PE=1 SV=1 206 461 2.0E-06
sp|O81346|C79B2_ARATH Tryptophan N-monooxygenase 1 OS=Arabidopsis thaliana GN=CYP79B2 PE=1 SV=2 275 464 2.0E-06
sp|Q9SD85|F3PH_ARATH Flavonoid 3'-monooxygenase OS=Arabidopsis thaliana GN=CYP75B1 PE=1 SV=1 250 466 3.0E-06
sp|P10611|CP4A4_RABIT Cytochrome P450 4A4 OS=Oryctolagus cuniculus GN=CYP4A4 PE=1 SV=3 299 462 3.0E-06
sp|H2DH19|C7D31_PANGI Cytochrome P450 CYP71D312 OS=Panax ginseng PE=2 SV=1 291 464 3.0E-06
sp|P10612|CP11A_PIG Cholesterol side-chain cleavage enzyme, mitochondrial OS=Sus scrofa GN=CYP11A1 PE=1 SV=1 260 496 3.0E-06
sp|O81971|C71D9_SOYBN Cytochrome P450 71D9 OS=Glycine max GN=CYP71D9 PE=2 SV=1 299 464 3.0E-06
sp|O15528|CP27B_HUMAN 25-hydroxyvitamin D-1 alpha hydroxylase, mitochondrial OS=Homo sapiens GN=CYP27B1 PE=1 SV=1 292 473 4.0E-06
sp|O55127|CP26A_MOUSE Cytochrome P450 26A1 OS=Mus musculus GN=Cyp26a1 PE=2 SV=1 170 486 4.0E-06
sp|P93531|C71D7_SOLCH Cytochrome P450 71D7 OS=Solanum chacoense GN=CYP71D7 PE=3 SV=1 292 464 4.0E-06
sp|P51870|CP4F5_RAT Cytochrome P450 4F5 OS=Rattus norvegicus GN=Cyp4f5 PE=2 SV=1 299 477 4.0E-06
sp|Q7YRB2|CP8B1_PIG 5-beta-cholestane-3-alpha,7-alpha-diol 12-alpha-hydroxylase OS=Sus scrofa GN=CYP8B1 PE=2 SV=1 6 464 4.0E-06
sp|P70085|CP17A_ORYLA Steroid 17-alpha-hydroxylase/17,20 lyase OS=Oryzias latipes GN=cyp17a1 PE=2 SV=1 288 464 5.0E-06
sp|P15129|CP4B1_RAT Cytochrome P450 4B1 OS=Rattus norvegicus GN=Cyp4b1 PE=1 SV=3 299 477 5.0E-06
sp|Q6WKZ0|C7D94_MENGR Cytochrome P450 71D94 OS=Mentha gracilis GN=CYP71D94 PE=2 SV=1 295 464 5.0E-06
sp|Q3MID2|CP4F3_RAT Leukotriene-B(4) omega-hydroxylase 2 OS=Rattus norvegicus GN=Cyp4f3 PE=2 SV=1 299 477 5.0E-06
sp|O48957|C99A1_SORBI Cytochrome P450 CYP99A1 (Fragment) OS=Sorghum bicolor GN=CYP99A1 PE=2 SV=1 167 496 5.0E-06
sp|Q9W011|C4D20_DROME Probable cytochrome P450 4d20 OS=Drosophila melanogaster GN=Cyp4d20 PE=3 SV=1 299 462 5.0E-06
sp|P29980|CPXN_NOSS1 Probable cytochrome P450 110 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=cyp110 PE=3 SV=3 238 476 5.0E-06
sp|P20816|CP4A2_RAT Cytochrome P450 4A2 OS=Rattus norvegicus GN=Cyp4a2 PE=1 SV=2 147 462 6.0E-06
sp|P79401|CP3AT_PIG Cytochrome P450 3A29 OS=Sus scrofa GN=CYP3A29 PE=2 SV=1 250 497 6.0E-06
sp|P9WPP9|CP51_MYCTU Lanosterol 14-alpha demethylase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=cyp51 PE=1 SV=1 245 497 6.0E-06
sp|P9WPP8|CP51_MYCTO Lanosterol 14-alpha demethylase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=cyp51 PE=3 SV=1 245 497 6.0E-06
sp|P0A513|CP51_MYCBO Lanosterol 14-alpha demethylase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=cyp51 PE=3 SV=1 245 497 6.0E-06
sp|Q9VYQ7|CP311_DROME Probable cytochrome P450 311a1 OS=Drosophila melanogaster GN=Cyp311a1 PE=2 SV=1 234 464 7.0E-06
sp|P78329|CP4F2_HUMAN Phylloquinone omega-hydroxylase CYP4F2 OS=Homo sapiens GN=CYP4F2 PE=1 SV=1 299 477 9.0E-06
sp|P11707|CP3A6_RABIT Cytochrome P450 3A6 OS=Oryctolagus cuniculus GN=CYP3A6 PE=2 SV=2 248 497 9.0E-06
sp|Q42798|C93A1_SOYBN 3,9-dihydroxypterocarpan 6A-monooxygenase OS=Glycine max GN=CYP93A1 PE=1 SV=1 138 466 9.0E-06
sp|P79202|CP11A_SHEEP Cholesterol side-chain cleavage enzyme, mitochondrial OS=Ovis aries GN=CYP11A1 PE=1 SV=1 297 496 9.0E-06
sp|Q43135|C79A1_SORBI Tyrosine N-monooxygenase OS=Sorghum bicolor GN=CYP79A1 PE=1 SV=3 232 457 1.0E-05
sp|O81077|ABAH2_ARATH Abscisic acid 8'-hydroxylase 2 OS=Arabidopsis thaliana GN=CYP707A2 PE=2 SV=1 284 466 1.0E-05
sp|I3PFJ5|C76AD_BETVU Cytochrome P450 76AD1 OS=Beta vulgaris GN=CYP76AD1 PE=2 SV=1 299 466 1.0E-05
sp|Q9STK8|C71AP_ARATH Cytochrome P450 71A25 OS=Arabidopsis thaliana GN=CYP71A25 PE=2 SV=1 310 464 1.0E-05
sp|A2RRT9|CP4V2_RAT Cytochrome P450 4V2 OS=Rattus norvegicus GN=Cyp4v2 PE=2 SV=1 299 496 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0005506 iron ion binding Yes
GO:0004497 monooxygenase activity Yes
GO:0016705 oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen Yes
GO:0020037 heme binding Yes
GO:0046914 transition metal ion binding No
GO:0046872 metal ion binding No
GO:0005488 binding No
GO:0097159 organic cyclic compound binding No
GO:0016491 oxidoreductase activity No
GO:0003824 catalytic activity No
GO:0046906 tetrapyrrole binding No
GO:0003674 molecular_function No
GO:0043169 cation binding No
GO:0043167 ion binding No
GO:1901363 heterocyclic compound binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 16 0.5

Transmembrane Domains

Domain # Start End Length
1 5 27 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
SC16a Pure fungal culture 0.04 0.00 0.25
CcL In ants, during behavior modification 386.77 0.00 824.17
CcD In ants, recently dead 4.38 0.99 7.77

Differential expression

Label1 Label2 Q-value Significant difference
SC16a CcL 0.303357 no
SC16a CcD 0.303357 no
CcL CcD 0.000286 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|2266
MPSNLLIIQAPIACALLFGLLLVEFGRRRKSKMPTIRRWPSIFPEFFDRLSYNGNAVELAREGYSKYKDGPFRLL
RMDMDLVIIPLKYASELRAVTSDKLDPLTASFDDNAGHLTKILLGSELHSDAIHRRLTPGLPRIIPVVVDELKFA
FDHVLPQGSDSSSWAAVNPYDMVLDLSSRAAARIFVGEPICRNEEFLQTIASYSRNSFRTIDTFRNLGSLVGLLG
RAMSSTVTDAQVQLAYVQRLLGDEVKRRRARPDDEKHDDFLQWCMDLARSEDESQPESIAHRTLGILSMAVVHTT
AMASTHMLFDLVSNPELLEALREEQRRVLPEGWPVINQKAMLEMRLLDSLMRESQRFNPVGEFTFRRIVRKPITL
SDGYRLQPGQQIAISAKNLNMDQAVISDADSFNPSRWATQPQASASFAHSSSANLHFGLGRYACPGRFFASYMIK
AIMSRLLLEYDMKLQGHGSHQRPPNIISGDKILPNRDAVVLLRRRNG
Coding >Ophio5|2266
ATGCCATCGAACCTCCTCATCATCCAGGCGCCCATCGCCTGTGCCCTACTCTTCGGCCTGCTCCTCGTCGAGTTT
GGGCGCAGGAGAAAAAGCAAGATGCCTACAATCAGAAGATGGCCGTCCATCTTTCCAGAGTTTTTCGACCGGCTC
AGCTACAACGGCAACGCGGTTGAGCTGGCTAGGGAGGGATACAGCAAGTACAAAGATGGGCCTTTCAGGCTGCTC
AGAATGGACATGGACTTGGTCATCATCCCTCTCAAGTATGCCTCGGAGCTGCGCGCCGTCACCAGCGACAAGCTC
GACCCCCTGACGGCCAGCTTCGATGACAACGCCGGTCACCTCACCAAGATCCTGTTGGGAAGCGAACTGCACTCC
GATGCTATTCATAGGCGTCTTACTCCGGGGCTTCCACGCATCATCCCCGTCGTGGTGGACGAGCTCAAGTTTGCC
TTTGATCACGTCTTGCCTCAGGGATCCGACTCGAGTTCATGGGCAGCAGTGAATCCGTACGACATGGTGCTGGAT
CTATCGTCCCGCGCCGCCGCCAGAATCTTCGTGGGTGAGCCCATTTGCCGCAATGAGGAGTTTCTGCAGACGATA
GCATCGTACAGTCGCAACAGCTTCAGAACCATCGACACGTTCCGTAACCTGGGCAGCCTAGTCGGTCTCTTGGGC
CGGGCCATGAGCTCAACCGTGACCGACGCCCAGGTCCAGCTGGCGTACGTTCAACGACTTCTTGGTGACGAGGTG
AAGAGGAGAAGAGCACGGCCGGATGATGAGAAGCATGACGACTTTCTTCAGTGGTGTATGGACCTGGCTCGCAGC
GAGGACGAGTCTCAGCCTGAATCTATAGCCCATCGTACGCTCGGTATTCTCAGCATGGCCGTCGTTCATACCACC
GCCATGGCCTCGACTCACATGCTTTTCGACCTCGTCTCCAATCCGGAGCTGCTCGAGGCGCTACGGGAAGAGCAG
CGGCGCGTCTTGCCCGAGGGATGGCCCGTCATCAACCAGAAGGCCATGCTTGAAATGAGGCTTCTCGACAGTCTA
ATGAGAGAGTCGCAGCGCTTCAACCCCGTTGGCGAATTCACCTTCCGGCGCATCGTGAGGAAGCCCATCACGCTG
TCGGACGGCTATCGACTGCAACCAGGACAACAGATTGCCATATCGGCCAAGAATCTCAACATGGATCAAGCTGTC
ATTTCCGATGCCGACTCTTTCAATCCCTCTCGCTGGGCAACGCAGCCGCAGGCCTCTGCCTCGTTTGCCCACAGC
AGCTCGGCCAATCTACATTTTGGCCTCGGCCGCTATGCCTGCCCGGGACGCTTCTTTGCCTCGTACATGATCAAG
GCCATCATGAGTCGCCTGCTGCTTGAATACGACATGAAGCTCCAAGGTCATGGCAGTCATCAACGTCCGCCAAAC
ATCATCTCCGGGGATAAGATTCTTCCAAATCGGGATGCCGTCGTTCTCCTTCGCCGTCGCAATGGA
Transcript >Ophio5|2266
ATGCCATCGAACCTCCTCATCATCCAGGCGCCCATCGCCTGTGCCCTACTCTTCGGCCTGCTCCTCGTCGAGTTT
GGGCGCAGGAGAAAAAGCAAGATGCCTACAATCAGAAGATGGCCGTCCATCTTTCCAGAGTTTTTCGACCGGCTC
AGCTACAACGGCAACGCGGTTGAGCTGGCTAGGGAGGGATACAGCAAGTACAAAGATGGGCCTTTCAGGCTGCTC
AGAATGGACATGGACTTGGTCATCATCCCTCTCAAGTATGCCTCGGAGCTGCGCGCCGTCACCAGCGACAAGCTC
GACCCCCTGACGGCCAGCTTCGATGACAACGCCGGTCACCTCACCAAGATCCTGTTGGGAAGCGAACTGCACTCC
GATGCTATTCATAGGCGTCTTACTCCGGGGCTTCCACGCATCATCCCCGTCGTGGTGGACGAGCTCAAGTTTGCC
TTTGATCACGTCTTGCCTCAGGGATCCGACTCGAGTTCATGGGCAGCAGTGAATCCGTACGACATGGTGCTGGAT
CTATCGTCCCGCGCCGCCGCCAGAATCTTCGTGGGTGAGCCCATTTGCCGCAATGAGGAGTTTCTGCAGACGATA
GCATCGTACAGTCGCAACAGCTTCAGAACCATCGACACGTTCCGTAACCTGGGCAGCCTAGTCGGTCTCTTGGGC
CGGGCCATGAGCTCAACCGTGACCGACGCCCAGGTCCAGCTGGCGTACGTTCAACGACTTCTTGGTGACGAGGTG
AAGAGGAGAAGAGCACGGCCGGATGATGAGAAGCATGACGACTTTCTTCAGTGGTGTATGGACCTGGCTCGCAGC
GAGGACGAGTCTCAGCCTGAATCTATAGCCCATCGTACGCTCGGTATTCTCAGCATGGCCGTCGTTCATACCACC
GCCATGGCCTCGACTCACATGCTTTTCGACCTCGTCTCCAATCCGGAGCTGCTCGAGGCGCTACGGGAAGAGCAG
CGGCGCGTCTTGCCCGAGGGATGGCCCGTCATCAACCAGAAGGCCATGCTTGAAATGAGGCTTCTCGACAGTCTA
ATGAGAGAGTCGCAGCGCTTCAACCCCGTTGGCGAATTCACCTTCCGGCGCATCGTGAGGAAGCCCATCACGCTG
TCGGACGGCTATCGACTGCAACCAGGACAACAGATTGCCATATCGGCCAAGAATCTCAACATGGATCAAGCTGTC
ATTTCCGATGCCGACTCTTTCAATCCCTCTCGCTGGGCAACGCAGCCGCAGGCCTCTGCCTCGTTTGCCCACAGC
AGCTCGGCCAATCTACATTTTGGCCTCGGCCGCTATGCCTGCCCGGGACGCTTCTTTGCCTCGTACATGATCAAG
GCCATCATGAGTCGCCTGCTGCTTGAATACGACATGAAGCTCCAAGGTCATGGCAGTCATCAACGTCCGCCAAAC
ATCATCTCCGGGGATAAGATTCTTCCAAATCGGGATGCCGTCGTTCTCCTTCGCCGTCGCAATGGATAG
Gene >Ophio5|2266
ATGCCATCGAACCTCCTCATCATCCAGGCGCCCATCGCCTGTGCCCTACTCTTCGGCCTGCTCCTCGTCGAGTTT
GGGCGCAGGAGAAAAAGCAAGATGCCTACAATCAGAAGATGGCCGTCCATCTTTCCAGAGTTTTTCGACCGGCTC
AGCTACAACGGCAACGCGGTTGAGCTGGCTAGGGAGGGATACAGCAAGGTTGCGTTCGCTGCCCTCCAGTTTTCA
CTGGATAGCTTCGACTGACGACTGTCTTTGAAGTACAAAGATGGGCCTTTCAGGCTGCTCAGAATGGACATGGAC
TTGGTCATCATCCCTCTCAAGTATGCCTCGGAGCTGCGCGCCGTCACCAGCGACAAGCTCGACCCCCTGACGGCC
AGCTTCGATGACAACGCCGGTCACCTCACCAAGATCCTGTTGGGAAGCGAACTGCACTCCGATGCTATTCATAGG
CGTCTTACTCCGGGGCTTCGTAGGTTTACTCGGGAAGATGGTGTATGTACATGGTGTTTATGTTCTTGTTTTCTA
AATCTGCTGCAGCACGCATCATCCCCGTCGTGGTGGACGAGCTCAAGTTTGCCTTTGATCACGTCTTGCCTCAGG
GATCCGACTCGAGTACGTTGGAGCAACAAGACCGAAATCTTGCCTTTTTCATCAACCGCTAAATGTCCTCTGCTT
CATCTAGGTTCATGGGCAGCAGTGAATCCGTACGACATGGTGCTGGATCTATCGTCCCGCGCCGCCGCCAGAATC
TTCGTGGGTGAGCCCATTTGCCGCAATGAGGAGTTTCTGCAGACGATAGCATCGTACAGTCGCAACAGCTTCAGA
ACCATCGACACGTTCCGTAACCTGGGCAGCCTAGTCGGTCTCTTGGGCCGGGCCATGAGCTCAACCGTGACCGAC
GCCCAGGTCCAGCTGGCGTACGTTCAACGACTTCTTGGTGACGAGGTGAAGAGGAGAAGAGCACGGCCGGATGAT
GAGAAGCATGACGACTTTCTTCAGTGGTGTATGGACCTGGCTCGCAGCGAGGACGAGTCTCAGCCTGAATCTATA
GCCCATCGTACGCTCGGTATTCTCAGCATGGCCGTCGTTCATACCACCGCCATGGCCTCGACTCACATGCTTTTC
GACCTCGTCTCCAATCCGGAGCTGCTCGAGGCGCTACGGGAAGAGCAGCGGCGCGTCTTGCCCGAGGGATGGCCC
GTCATCAACCAGAAGGCCATGCTTGAAATGAGGCTTCTCGACAGTCTAATGAGAGAGTCGCAGCGCTTCAACCCC
GTTGGCGAATGTGAGTTGCTGCCGCTTCTCGAGTCGATAGGAGTCTAATCCGCCCCCCTTTTAGTCACCTTCCGG
CGCATCGTGAGGAAGCCCATCACGCTGTCGGACGGCTATCGACTGCAACCAGGACAACAGATTGCCATATCGGCC
AAGAATCTCAACATGGATCAAGCTGTCATTTCCGATGCCGACTCTTTCAATCCCTCTCGCTGGGCAACGCAGCCG
CAGGCCTCTGCCTCGTTTGCCCACAGCAGCTCGGCCAATCTACATTTTGGCCTCGGCCGCTATGCCTGCCCGGGA
CGCTTCTTTGCCTCGGTACGTTTTTGTTTTCCCCCCCTCGATATTTTTTTTTTTTACTTTGGTCTCAGAGTTGCC
AACTTCGTGTCGGTTGATAGTACATGATCAAGGCCATCATGAGTCGCCTGCTGCTTGAATACGACATGAAGCTCC
AAGGTCATGGCAGTCATCAACGTCCGCCAAACATCATCTCCGGGGATAAGATTCTTCCAAATCGGGATGCCGTCG
TTCTCCTTCGCCGTCGCAATGGATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail