Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|2265
Gene name
Locationscaffold_194:8001..9442
Strand-
Gene length (bp)1441
Transcript length (bp)1308
Coding sequence length (bp)1305
Protein length (aa) 435

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF11991 Trp_DMAT Tryptophan dimethylallyltransferase 8.7E-87 18 378

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q4WYG3|7DMAW_ASPFU 7-dimethylallyltryptophan synthase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=etpPT PE=1 SV=2 14 420 3.0E-33
sp|Q6X1E1|DMAW_BALOB Tryptophan dimethylallyltransferase OS=Balansia obtecta GN=dmaW PE=3 SV=1 20 410 3.0E-21
sp|Q6Q874|SIRD_LEPMC 4-O-dimethylallyl-L-tyrosine synthase OS=Leptosphaeria maculans GN=sirD PE=1 SV=1 16 367 9.0E-21
sp|M1WA41|DMAW1_CLAP2 Tryptophan dimethylallyltransferase 1 OS=Claviceps purpurea (strain 20.1) GN=dmaW1 PE=3 SV=1 20 312 2.0E-20
sp|A1DJ20|FTMT3_NEOFI Verruculogen prenyltransferase OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=ftmPT3 PE=1 SV=1 20 419 2.0E-19
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q4WYG3|7DMAW_ASPFU 7-dimethylallyltryptophan synthase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=etpPT PE=1 SV=2 14 420 3.0E-33
sp|Q6X1E1|DMAW_BALOB Tryptophan dimethylallyltransferase OS=Balansia obtecta GN=dmaW PE=3 SV=1 20 410 3.0E-21
sp|Q6Q874|SIRD_LEPMC 4-O-dimethylallyl-L-tyrosine synthase OS=Leptosphaeria maculans GN=sirD PE=1 SV=1 16 367 9.0E-21
sp|M1WA41|DMAW1_CLAP2 Tryptophan dimethylallyltransferase 1 OS=Claviceps purpurea (strain 20.1) GN=dmaW1 PE=3 SV=1 20 312 2.0E-20
sp|A1DJ20|FTMT3_NEOFI Verruculogen prenyltransferase OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=ftmPT3 PE=1 SV=1 20 419 2.0E-19
sp|P0CT20|DMAW1_CLAPU Tryptophan dimethylallyltransferase 1 OS=Claviceps purpurea GN=dmaW1 PE=1 SV=1 20 312 3.0E-19
sp|Q6X2E3|DMAW_EPINE Tryptophan dimethylallyltransferase OS=Epichloe typhina x Neotyphodium lolii GN=dmaW PE=3 SV=1 16 410 1.0E-18
sp|Q6X2E1|DMAW2_EPICN Tryptophan dimethylallyltransferase 2 OS=Epichloe coenophiala GN=dmaW2 PE=3 SV=1 16 410 1.0E-18
sp|Q12594|DMAW_CLAFS Tryptophan dimethylallyltransferase OS=Claviceps fusiformis GN=dmaW PE=1 SV=1 20 410 1.0E-18
sp|Q6X2E2|DMAW1_EPICN Tryptophan dimethylallyltransferase 1 OS=Epichloe coenophiala GN=dmaW1 PE=3 SV=1 16 306 4.0E-18
sp|Q9C141|DMAW2_CLAP2 Tryptophan dimethylallyltransferase 2 OS=Claviceps purpurea (strain 20.1) GN=dmaW2 PE=3 SV=1 20 312 2.0E-17
sp|Q50EL0|DMAW_ASPFU Tryptophan dimethylallyltransferase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=fgaPT2 PE=1 SV=2 16 306 6.0E-15
sp|Q4WZ67|FGPT1_ASPFU Fumigaclavine A dimethylallyltransferase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=fgaPT1 PE=1 SV=1 19 305 3.0E-13
sp|I4AY86|BREPT_ASPVE Brevianamide F reverse prenyltransferase OS=Aspergillus versicolor GN=brePT PE=1 SV=1 28 419 8.0E-13
sp|A1DA62|FTMB_NEOFI Tryprostatin B synthase OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=ftmPT1 PE=3 SV=2 20 299 5.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0009820 alkaloid metabolic process Yes
GO:0016765 transferase activity, transferring alkyl or aryl (other than methyl) groups Yes
GO:0071704 organic substance metabolic process No
GO:0003824 catalytic activity No
GO:0016740 transferase activity No
GO:0006807 nitrogen compound metabolic process No
GO:0003674 molecular_function No
GO:0008152 metabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0008150 biological_process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 40 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|2265
MAIKSVANDDKPSAVDLAYWERNLVPVMSSLMKSAGTYSTAEQEAQLRLLTEHVLPRLGPRMPAAYTTSFLTHSD
SPLQPQMNFRPGKSTVRYCWEPLGTRGGSESDPFAIDAAREAMQHLSTTFGLCTQWSDALLSAFAPTPEEVGVVQ
ALLPGWLASLGPASTIPAINRLPFSMIGMDMRGSEVDIKAYFNIKIKEFATKLPVTDLAFDALRKLKPSLEPAAI
DAVEKFLSDRPVPSAIEIIGIDWVDQGKMSDARVKLYVHCRNNSFNTVREYVTLGGLIQDETTLNGLEQLYKIWH
LLLQEPEGIPNEDYDKPLTGNSAMYQKLYFSFELRPGKKLPEVKTYLPTWHYVRSDEETVQNYEEVFRLCRLPWG
QDGQYKKLFEGAFGPVKHNRPSPVHCDASFFFSSNMGIYQTLYWSPPLETGGETEETRVA
Coding >Ophio5|2265
ATGGCCATCAAATCTGTGGCAAACGACGACAAGCCATCAGCCGTCGACTTGGCCTACTGGGAACGAAACCTCGTC
CCCGTCATGAGCTCGCTCATGAAGTCTGCCGGGACCTACTCTACCGCCGAGCAGGAGGCACAGCTGCGTCTCCTG
ACTGAGCATGTTCTACCGCGGCTGGGACCGAGAATGCCGGCCGCCTACACGACGTCGTTTCTGACTCATAGCGAC
TCTCCTCTGCAGCCTCAGATGAACTTCAGGCCCGGAAAGTCCACGGTCCGCTATTGCTGGGAGCCGTTGGGCACG
CGAGGCGGCAGCGAGAGCGACCCGTTCGCCATAGACGCCGCTCGAGAGGCGATGCAGCATCTTTCTACCACCTTT
GGCCTCTGCACGCAGTGGAGTGATGCCTTGCTCTCGGCCTTTGCCCCGACGCCTGAGGAAGTTGGAGTGGTTCAA
GCTCTGCTTCCGGGATGGCTGGCCAGCCTTGGGCCAGCATCCACTATTCCCGCCATTAATCGACTTCCCTTTAGC
ATGATTGGCATGGATATGAGGGGATCCGAGGTGGACATCAAGGCCTACTTTAACATCAAGATCAAGGAGTTTGCA
ACAAAGTTGCCGGTGACAGACTTGGCTTTTGACGCCTTACGGAAACTGAAGCCGTCTCTAGAGCCAGCGGCGATT
GATGCGGTTGAAAAATTCCTCTCAGACCGCCCCGTTCCGTCCGCTATTGAGATCATAGGAATCGACTGGGTCGAT
CAAGGCAAAATGTCCGACGCCCGAGTCAAGCTCTACGTCCATTGCAGAAACAATTCTTTCAACACCGTCCGCGAG
TACGTCACTCTCGGCGGCCTCATCCAAGACGAGACGACCTTGAACGGTCTGGAGCAGCTGTACAAGATCTGGCAC
CTGCTGCTCCAAGAGCCCGAGGGTATCCCCAACGAGGACTACGACAAGCCGCTGACCGGCAACTCTGCCATGTAT
CAGAAGCTGTACTTTAGCTTCGAGTTGAGGCCTGGCAAAAAGCTGCCCGAGGTTAAGACCTACTTGCCGACCTGG
CACTACGTACGAAGCGACGAGGAGACGGTGCAAAACTACGAAGAAGTCTTTCGTCTGTGCCGACTCCCGTGGGGA
CAGGACGGTCAATACAAGAAGCTGTTCGAGGGCGCCTTCGGTCCGGTTAAACATAACCGACCGAGCCCGGTTCAC
TGCGATGCCTCGTTTTTCTTCTCCTCGAATATGGGCATCTACCAGACGCTGTACTGGAGCCCACCTCTTGAGACT
GGTGGCGAGACTGAAGAGACCAGAGTCGCG
Transcript >Ophio5|2265
ATGGCCATCAAATCTGTGGCAAACGACGACAAGCCATCAGCCGTCGACTTGGCCTACTGGGAACGAAACCTCGTC
CCCGTCATGAGCTCGCTCATGAAGTCTGCCGGGACCTACTCTACCGCCGAGCAGGAGGCACAGCTGCGTCTCCTG
ACTGAGCATGTTCTACCGCGGCTGGGACCGAGAATGCCGGCCGCCTACACGACGTCGTTTCTGACTCATAGCGAC
TCTCCTCTGCAGCCTCAGATGAACTTCAGGCCCGGAAAGTCCACGGTCCGCTATTGCTGGGAGCCGTTGGGCACG
CGAGGCGGCAGCGAGAGCGACCCGTTCGCCATAGACGCCGCTCGAGAGGCGATGCAGCATCTTTCTACCACCTTT
GGCCTCTGCACGCAGTGGAGTGATGCCTTGCTCTCGGCCTTTGCCCCGACGCCTGAGGAAGTTGGAGTGGTTCAA
GCTCTGCTTCCGGGATGGCTGGCCAGCCTTGGGCCAGCATCCACTATTCCCGCCATTAATCGACTTCCCTTTAGC
ATGATTGGCATGGATATGAGGGGATCCGAGGTGGACATCAAGGCCTACTTTAACATCAAGATCAAGGAGTTTGCA
ACAAAGTTGCCGGTGACAGACTTGGCTTTTGACGCCTTACGGAAACTGAAGCCGTCTCTAGAGCCAGCGGCGATT
GATGCGGTTGAAAAATTCCTCTCAGACCGCCCCGTTCCGTCCGCTATTGAGATCATAGGAATCGACTGGGTCGAT
CAAGGCAAAATGTCCGACGCCCGAGTCAAGCTCTACGTCCATTGCAGAAACAATTCTTTCAACACCGTCCGCGAG
TACGTCACTCTCGGCGGCCTCATCCAAGACGAGACGACCTTGAACGGTCTGGAGCAGCTGTACAAGATCTGGCAC
CTGCTGCTCCAAGAGCCCGAGGGTATCCCCAACGAGGACTACGACAAGCCGCTGACCGGCAACTCTGCCATGTAT
CAGAAGCTGTACTTTAGCTTCGAGTTGAGGCCTGGCAAAAAGCTGCCCGAGGTTAAGACCTACTTGCCGACCTGG
CACTACGTACGAAGCGACGAGGAGACGGTGCAAAACTACGAAGAAGTCTTTCGTCTGTGCCGACTCCCGTGGGGA
CAGGACGGTCAATACAAGAAGCTGTTCGAGGGCGCCTTCGGTCCGGTTAAACATAACCGACCGAGCCCGGTTCAC
TGCGATGCCTCGTTTTTCTTCTCCTCGAATATGGGCATCTACCAGACGCTGTACTGGAGCCCACCTCTTGAGACT
GGTGGCGAGACTGAAGAGACCAGAGTCGCGTAG
Gene >Ophio5|2265
ATGGCCATCAAATCTGTGGCAAACGACGACAAGCCATCAGCCGTCGACTTGGCCTACTGGGAACGAAACCTCGTC
CCCGTCATGAGCTCGCTCATGAAGTCTGCCGGGACCTACTCTACCGCCGAGCAGGAGGCACAGCTGCGTCTCCTG
ACTGAGCATGTTCTACCGCGGCTGGGACCGAGAATGCCGGCCGCCTACACGACGTCGTTTCTGACTCATAGCGAC
TCTCCTCTGCAGCCTCAGATGAACTTCAGGCCCGGAAAGTCCACGGTCCGCTATTGCTGGGAGCCGTTGGGCACG
CGAGGCGGCAGCGAGAGCGACCCGTTCGCCATAGACGCCGCTCGAGAGGCGATGCAGCATCTTTCTACCACCTTT
GGCCTCTGCACGCAGTGGAGTGATGCCTTGCTCTCGGCCTTTGCCCCGACGCCTGAGGAAGTTGGAGTGGTTCAA
GCTCTGCTTCCGGGATGGCTGGCCAGCCTTGGGCCAGCATCCACTATTCCCGCCATTAATCGACTTCCCTTTAGC
ATGATTGGCATGGATATGAGGGGATCCGAGGTGGACATCAAGGCCTACTTTAACATCAAGATCAAGGAGTTTGCA
ACAAAGTTGCCGGTGACAGACTTGGCTTTTGACGCCTTACGGAAACTGAAGCCGTCTCTAGAGCCAGCGGCGATT
GATGCGGTTGAAAAGTACGAGGTTTCTATCTTTTATGCGTGCGCCCGTCACTGAATTATACCGTCTTCCAAGATT
CCTCTCAGACCGCCCCGTTCCGTCCGCTATTGAGATCATAGGAATCGACTGGGTCGATCAAGGCAAAATGTCCGA
CGCCCGAGTCAAGCTCTACGTCCATTGCAGAAACAATTCTTTCAACACCGTCCGCGAGTACGTCACTCTCGGCGG
CCTCATCCAAGACGAGACGACCTTGAACGGTCTGGAGCAGCTGTACAAGATCTGGCACCTGCTGCTCCAAGAGCC
CGAGGGTATCCCCAACGAGGACTACGACAAGCCGCTGACCGGCAACTCTGCCATGTATCAGAAGCTGTACTTTAG
CTTCGAGTTGAGGCCTGGCAAAAAGCTGCCCGAGGTTAAGACCTACTTGCCGACCTGGCACTACGTACGAAGCGA
CGAGGAGACGGTGCAAAACTACGAAGAAGTCTTTCGTCTGTGCCGACTCCCGTGGGGACAGGACGGTCAATACAA
GAAGCTGTTCGAGGGCGCCTTGTAAGTGTCCCTGCCTGGGTGATTGATACCACCAAGGGCTGTACTGACGCCAGG
CTACTGTTCGCCGTCTTACAGCGGTCCGGTTAAACATAACCGACCGAGCCCGGTTCACTGCGATGCCTCGTTTTT
CTTCTCCTCGAATATGGGCATCTACCAGACGCTGTACTGGAGCCCACCTCTTGAGACTGGTGGCGAGACTGAAGA
GACCAGAGTCGCGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail