Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|2264
Gene name
Locationscaffold_194:5289..7323
Strand-
Gene length (bp)2034
Transcript length (bp)1590
Coding sequence length (bp)1587
Protein length (aa) 529

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00067 p450 Cytochrome P450 1.9E-32 146 497

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q701P2|KO1_GIBIN Ent-kaurene oxidase OS=Gibberella intermedia GN=CYP503A1 PE=1 SV=1 34 503 5.0E-98
sp|O94142|KO1_GIBFU Ent-kaurene oxidase OS=Gibberella fujikuroi GN=CYP503A1 PE=1 SV=1 34 503 9.0E-98
sp|Q4WAX0|FTMG_ASPFU Fumitremorgin C monooxygenase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=ftmP450-3 PE=3 SV=1 47 494 6.0E-47
sp|B9WZX6|FTMG_ASPFM Fumitremorgin C monooxygenase OS=Neosartorya fumigata GN=ftmP450-3 PE=1 SV=1 47 494 1.0E-46
sp|A1DA65|FTMG_NEOFI Fumitremorgin C monooxygenase OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=ftmP450-3 PE=3 SV=1 56 494 1.0E-43
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q701P2|KO1_GIBIN Ent-kaurene oxidase OS=Gibberella intermedia GN=CYP503A1 PE=1 SV=1 34 503 5.0E-98
sp|O94142|KO1_GIBFU Ent-kaurene oxidase OS=Gibberella fujikuroi GN=CYP503A1 PE=1 SV=1 34 503 9.0E-98
sp|Q4WAX0|FTMG_ASPFU Fumitremorgin C monooxygenase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=ftmP450-3 PE=3 SV=1 47 494 6.0E-47
sp|B9WZX6|FTMG_ASPFM Fumitremorgin C monooxygenase OS=Neosartorya fumigata GN=ftmP450-3 PE=1 SV=1 47 494 1.0E-46
sp|A1DA65|FTMG_NEOFI Fumitremorgin C monooxygenase OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=ftmP450-3 PE=3 SV=1 56 494 1.0E-43
sp|Q9Y7C8|LOVA_ASPTE Dihydromonacolin L monooxygenase LovA OS=Aspergillus terreus GN=lovA PE=1 SV=1 49 519 2.0E-42
sp|Q9UVC3|CP51_CUNEL Lanosterol 14-alpha demethylase OS=Cunninghamella elegans GN=CYP51 PE=3 SV=1 240 488 1.0E-15
sp|S4UX02|CYPH1_SALMI Ferruginol synthase OS=Salvia miltiorrhiza GN=CYP76AH1 PE=1 SV=1 237 505 6.0E-15
sp|Q9DBG1|CP27A_MOUSE Sterol 26-hydroxylase, mitochondrial OS=Mus musculus GN=Cyp27a1 PE=1 SV=1 228 493 3.0E-13
sp|P17178|CP27A_RAT Sterol 26-hydroxylase, mitochondrial OS=Rattus norvegicus GN=Cyp27a1 PE=1 SV=1 231 487 7.0E-13
sp|Q947B7|MFS_MENPI (+)-menthofuran synthase OS=Mentha piperita PE=1 SV=1 266 516 1.0E-11
sp|A1DA60|FTMC_NEOFI Tryprostatin B 6-hydroxylase OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=ftmP450-1 PE=3 SV=1 202 519 2.0E-11
sp|Q4WAW5|FTMC_ASPFU Tryprostatin B 6-hydroxylase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=ftmP450-1 PE=3 SV=2 202 519 2.0E-11
sp|B9WZX1|FTMC_ASPFM Tryprostatin B 6-hydroxylase OS=Neosartorya fumigata GN=ftmP450-1 PE=1 SV=1 202 519 2.0E-11
sp|Q02318|CP27A_HUMAN Sterol 26-hydroxylase, mitochondrial OS=Homo sapiens GN=CYP27A1 PE=1 SV=1 231 486 4.0E-11
sp|Q9V5L3|C49A1_DROME Probable cytochrome P450 49a1 OS=Drosophila melanogaster GN=Cyp49a1 PE=2 SV=3 308 493 4.0E-11
sp|Q8N118|CP4X1_HUMAN Cytochrome P450 4X1 OS=Homo sapiens GN=CYP4X1 PE=2 SV=1 244 499 7.0E-11
sp|P51870|CP4F5_RAT Cytochrome P450 4F5 OS=Rattus norvegicus GN=Cyp4f5 PE=2 SV=1 270 486 1.0E-10
sp|Q9WVK8|CP46A_MOUSE Cholesterol 24-hydroxylase OS=Mus musculus GN=Cyp46a1 PE=1 SV=1 119 493 1.0E-10
sp|P24464|CP4AC_RAT Cytochrome P450 4A12 OS=Rattus norvegicus GN=Cyp4a12 PE=2 SV=2 312 487 2.0E-10
sp|Q9V4U7|C6A14_DROME Probable cytochrome P450 6a14 OS=Drosophila melanogaster GN=Cyp6a14 PE=3 SV=2 278 498 4.0E-10
sp|P49602|CP51_USTMA Lanosterol 14-alpha demethylase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=ERG11 PE=3 SV=1 153 491 5.0E-10
sp|P17177|CP27A_RABIT Sterol 26-hydroxylase, mitochondrial OS=Oryctolagus cuniculus GN=CYP27A1 PE=2 SV=1 231 488 6.0E-10
sp|P15539|C11B2_MOUSE Cytochrome P450 11B2, mitochondrial OS=Mus musculus GN=Cyp11b2 PE=2 SV=3 310 483 9.0E-10
sp|Q96514|C71B7_ARATH Cytochrome P450 71B7 OS=Arabidopsis thaliana GN=CYP71B7 PE=1 SV=1 276 504 1.0E-09
sp|Q91WL5|CP4CA_MOUSE Cytochrome P450 4A12A OS=Mus musculus GN=Cyp4a12a PE=1 SV=2 312 488 1.0E-09
sp|Q964T1|CP4CU_BLAGE Cytochrome P450 4c21 OS=Blattella germanica GN=CYP4C21 PE=2 SV=1 218 489 1.0E-09
sp|Q1ZXH9|CP51_DICDI Probable lanosterol 14-alpha demethylase OS=Dictyostelium discoideum GN=cyp51 PE=3 SV=1 240 489 1.0E-09
sp|Q9V4U9|C6A13_DROME Probable cytochrome P450 6a13 OS=Drosophila melanogaster GN=Cyp6a13 PE=2 SV=1 258 505 1.0E-09
sp|O64638|C76C3_ARATH Cytochrome P450 76C3 OS=Arabidopsis thaliana GN=CYP76C3 PE=2 SV=2 254 493 2.0E-09
sp|O46420|CP51A_PIG Lanosterol 14-alpha demethylase OS=Sus scrofa GN=CYP51A1 PE=2 SV=1 230 520 2.0E-09
sp|P14263|CP51_CANTR Lanosterol 14-alpha demethylase OS=Candida tropicalis GN=ERG11 PE=3 SV=2 240 490 3.0E-09
sp|P13584|CP4B1_HUMAN Cytochrome P450 4B1 OS=Homo sapiens GN=CYP4B1 PE=1 SV=2 312 488 3.0E-09
sp|Q59990|CP120_SYNY3 Putative cytochrome P450 120 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=cyp120 PE=1 SV=1 286 495 5.0E-09
sp|P08684|CP3A4_HUMAN Cytochrome P450 3A4 OS=Homo sapiens GN=CYP3A4 PE=1 SV=4 231 521 6.0E-09
sp|P58048|C71B8_ARATH Cytochrome P450 71B8 OS=Arabidopsis thaliana GN=CYP71B8 PE=3 SV=1 282 495 6.0E-09
sp|P30100|C11B3_RAT Cytochrome P450 11B3, mitochondrial OS=Rattus norvegicus GN=Cyp11b3 PE=1 SV=1 310 474 6.0E-09
sp|Q6Z5I7|C76M6_ORYSJ Oryzalexin E synthase OS=Oryza sativa subsp. japonica GN=CYP76M6 PE=1 SV=1 268 514 6.0E-09
sp|P24462|CP3A7_HUMAN Cytochrome P450 3A7 OS=Homo sapiens GN=CYP3A7 PE=1 SV=2 231 528 7.0E-09
sp|O35728|CP4AE_MOUSE Cytochrome P450 4A14 OS=Mus musculus GN=Cyp4a14 PE=1 SV=1 312 487 8.0E-09
sp|O88833|CP4AA_MOUSE Cytochrome P450 4A10 OS=Mus musculus GN=Cyp4a10 PE=2 SV=2 312 487 8.0E-09
sp|Q964T2|CP9E2_BLAGE Cytochrome P450 9e2 OS=Blattella germanica GN=CYP9E2 PE=2 SV=1 307 498 8.0E-09
sp|P30099|C11B2_RAT Cytochrome P450 11B2, mitochondrial OS=Rattus norvegicus GN=Cyp11b2 PE=1 SV=1 310 474 1.0E-08
sp|P15393|C11B1_RAT Cytochrome P450 11B1, mitochondrial OS=Rattus norvegicus GN=Cyp11b1 PE=1 SV=1 310 474 1.0E-08
sp|P78329|CP4F2_HUMAN Phylloquinone omega-hydroxylase CYP4F2 OS=Homo sapiens GN=CYP4F2 PE=1 SV=1 312 486 1.0E-08
sp|Q8K4D6|CP4X1_RAT Cytochrome P450 4X1 OS=Rattus norvegicus GN=Cyp4x1 PE=2 SV=1 264 497 1.0E-08
sp|P48421|C83A1_ARATH Cytochrome P450 83A1 OS=Arabidopsis thaliana GN=CYP83A1 PE=1 SV=2 271 493 1.0E-08
sp|Q42600|C84A1_ARATH Cytochrome P450 84A1 OS=Arabidopsis thaliana GN=CYP84A1 PE=1 SV=1 306 493 1.0E-08
sp|P10613|CP51_CANAL Lanosterol 14-alpha demethylase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ERG11 PE=3 SV=2 240 483 1.0E-08
sp|O81970|C71A9_SOYBN Cytochrome P450 71A9 OS=Glycine max GN=CYP71A9 PE=2 SV=1 281 493 2.0E-08
sp|Q4R8S6|CP51A_MACFA Lanosterol 14-alpha demethylase OS=Macaca fascicularis GN=CYP51A1 PE=2 SV=2 230 520 2.0E-08
sp|P24557|THAS_HUMAN Thromboxane-A synthase OS=Homo sapiens GN=TBXAS1 PE=1 SV=3 296 489 2.0E-08
sp|Q9Y6A2|CP46A_HUMAN Cholesterol 24-hydroxylase OS=Homo sapiens GN=CYP46A1 PE=1 SV=1 152 493 2.0E-08
sp|Q5RE72|CP51A_PONAB Lanosterol 14-alpha demethylase OS=Pongo abelii GN=CYP51A1 PE=2 SV=2 230 520 2.0E-08
sp|D1MI46|C76BA_SWEMU Geraniol 8-hydroxylase OS=Swertia mussotii GN=CYP76B10 PE=1 SV=1 237 504 2.0E-08
sp|P20815|CP3A5_HUMAN Cytochrome P450 3A5 OS=Homo sapiens GN=CYP3A5 PE=1 SV=1 282 521 2.0E-08
sp|Q29624|CP191_PIG Aromatase 1 OS=Sus scrofa GN=CYP19A1 PE=2 SV=1 79 491 2.0E-08
sp|O04164|C71A6_NEPRA Cytochrome P450 71A6 (Fragment) OS=Nepeta racemosa GN=CYP71A6 PE=2 SV=1 258 493 3.0E-08
sp|P14581|CP4A7_RABIT Cytochrome P450 4A7 OS=Oryctolagus cuniculus GN=CYP4A7 PE=1 SV=1 263 488 3.0E-08
sp|Q8SPK1|CP4AO_PIG Cytochrome P450 4A24 OS=Sus scrofa GN=CYP4A24 PE=2 SV=1 312 498 3.0E-08
sp|Q64581|CP3AI_RAT Cytochrome P450 3A18 OS=Rattus norvegicus GN=Cyp3a18 PE=2 SV=1 230 521 3.0E-08
sp|Q42716|C71A8_MENPI Cytochrome P450 71A8 OS=Mentha piperita GN=CYP71A8 PE=3 SV=1 308 491 3.0E-08
sp|Q69X58|C76M7_ORYSJ Ent-cassadiene C11-alpha-hydroxylase 1 OS=Oryza sativa subsp. japonica GN=CYP76M7 PE=1 SV=1 233 495 3.0E-08
sp|Q02928|CP4AB_HUMAN Cytochrome P450 4A11 OS=Homo sapiens GN=CYP4A11 PE=1 SV=1 312 526 4.0E-08
sp|Q8SPK0|CP4AP_PIG Cytochrome P450 4A25 OS=Sus scrofa GN=CYP4A25 PE=2 SV=1 312 498 4.0E-08
sp|Q9V7G5|C4AA1_DROME Probable cytochrome P450 4aa1 OS=Drosophila melanogaster GN=Cyp4aa1 PE=2 SV=2 264 486 4.0E-08
sp|P51871|CP4F6_RAT Cytochrome P450 4F6 OS=Rattus norvegicus GN=Cyp4f6 PE=2 SV=1 312 486 4.0E-08
sp|P14580|CP4A6_RABIT Cytochrome P450 4A6 OS=Oryctolagus cuniculus GN=CYP4A6 PE=1 SV=1 263 488 4.0E-08
sp|Q6WKZ0|C7D94_MENGR Cytochrome P450 71D94 OS=Mentha gracilis GN=CYP71D94 PE=2 SV=1 308 509 4.0E-08
sp|P08516|CP4AA_RAT Cytochrome P450 4A10 OS=Rattus norvegicus GN=Cyp4a10 PE=1 SV=2 312 487 5.0E-08
sp|D5J9U8|GAO_LACSA Germacrene A oxidase OS=Lactuca sativa GN=GAO1 PE=1 SV=1 314 516 5.0E-08
sp|O18635|C12A2_MUSDO Cytochrome P450 CYP12A2 OS=Musca domestica GN=CYP12A2 PE=2 SV=1 244 495 5.0E-08
sp|Q6A152|CP4X1_MOUSE Cytochrome P450 4X1 OS=Mus musculus GN=Cyp4x1 PE=1 SV=1 264 500 5.0E-08
sp|P48416|CP10_LYMST Cytochrome P450 10 OS=Lymnaea stagnalis GN=CYP10 PE=2 SV=1 310 498 6.0E-08
sp|Q9HCS2|CP4FC_HUMAN Cytochrome P450 4F12 OS=Homo sapiens GN=CYP4F12 PE=1 SV=2 312 488 6.0E-08
sp|O48958|C71E1_SORBI 4-hydroxyphenylacetaldehyde oxime monooxygenase OS=Sorghum bicolor GN=CYP71E1 PE=2 SV=1 271 516 6.0E-08
sp|Q16850|CP51A_HUMAN Lanosterol 14-alpha demethylase OS=Homo sapiens GN=CYP51A1 PE=1 SV=3 230 520 6.0E-08
sp|E1BHJ4|CP26B_BOVIN Cytochrome P450 26B1 OS=Bos taurus GN=CYP26B1 PE=3 SV=1 267 482 7.0E-08
sp|O65012|C78A4_PINRA Cytochrome P450 78A4 OS=Pinus radiata GN=CYP78A4 PE=2 SV=1 233 499 7.0E-08
sp|Q9SAE3|C71BS_ARATH Cytochrome P450 71B28 OS=Arabidopsis thaliana GN=CYP71B28 PE=2 SV=1 179 491 7.0E-08
sp|Q811W2|CP26B_MOUSE Cytochrome P450 26B1 OS=Mus musculus GN=Cyp26b1 PE=1 SV=1 267 482 7.0E-08
sp|P58051|C71BE_ARATH Cytochrome P450 71B14 OS=Arabidopsis thaliana GN=CYP71B14 PE=2 SV=1 308 493 7.0E-08
sp|P33274|CP4F1_RAT Cytochrome P450 4F1 OS=Rattus norvegicus GN=Cyp4f1 PE=2 SV=1 249 486 8.0E-08
sp|Q6YTF5|C76M5_ORYSJ Cytochrome P450 76M5 OS=Oryza sativa subsp. japonica GN=CYP76M5 PE=1 SV=1 282 495 8.0E-08
sp|P15129|CP4B1_RAT Cytochrome P450 4B1 OS=Rattus norvegicus GN=Cyp4b1 PE=1 SV=3 253 488 1.0E-07
sp|O18993|CP3AL_CALJA Cytochrome P450 3A21 OS=Callithrix jacchus GN=CYP3A21 PE=2 SV=1 233 521 1.0E-07
sp|Q9HB55|CP343_HUMAN Cytochrome P450 3A43 OS=Homo sapiens GN=CYP3A43 PE=1 SV=1 282 527 1.0E-07
sp|P14579|CP4A5_RABIT Cytochrome P450 4A5 OS=Oryctolagus cuniculus GN=CYP4A5 PE=2 SV=1 263 488 1.0E-07
sp|P51869|CP4F4_RAT Cytochrome P450 4F4 OS=Rattus norvegicus GN=Cyp4f4 PE=2 SV=1 312 486 1.0E-07
sp|P10611|CP4A4_RABIT Cytochrome P450 4A4 OS=Oryctolagus cuniculus GN=CYP4A4 PE=1 SV=3 263 488 1.0E-07
sp|O00061|CP67_UROFA Cytochrome P450 67 (Fragment) OS=Uromyces fabae GN=CYP67 PE=2 SV=1 302 493 1.0E-07
sp|Q2PG45|THAS_MACFA Thromboxane-A synthase OS=Macaca fascicularis GN=TBXAS1 PE=2 SV=2 307 489 1.0E-07
sp|Q9GJX5|CP4AL_PIG Taurochenodeoxycholic 6 alpha-hydroxylase OS=Sus scrofa GN=CYP4A21 PE=1 SV=1 312 498 1.0E-07
sp|Q63688|CP7B1_RAT 25-hydroxycholesterol 7-alpha-hydroxylase (Fragment) OS=Rattus norvegicus GN=Cyp7b1 PE=1 SV=1 297 501 1.0E-07
sp|P98187|CP4F8_HUMAN Cytochrome P450 4F8 OS=Homo sapiens GN=CYP4F8 PE=1 SV=1 312 486 1.0E-07
sp|P47787|THAS_PIG Thromboxane-A synthase OS=Sus scrofa GN=TBXAS1 PE=2 SV=1 307 489 1.0E-07
sp|Q98T91|C340_ORYLA Cytochrome P450 3A40 OS=Oryzias latipes GN=cyp3a40 PE=2 SV=1 282 505 1.0E-07
sp|O64636|C76C1_ARATH Cytochrome P450 76C1 OS=Arabidopsis thaliana GN=CYP76C1 PE=2 SV=1 249 493 1.0E-07
sp|Q96SQ9|CP2S1_HUMAN Cytochrome P450 2S1 OS=Homo sapiens GN=CYP2S1 PE=1 SV=2 282 491 1.0E-07
sp|Q9XS28|CP19A_SHEEP Aromatase OS=Ovis aries GN=CYP19A1 PE=2 SV=1 79 493 2.0E-07
sp|Q6YI21|CP19A_CAPHI Aromatase OS=Capra hircus GN=CYP19A1 PE=2 SV=1 79 493 2.0E-07
sp|P15128|CP4B1_RABIT Cytochrome P450 4B1 OS=Oryctolagus cuniculus GN=CYP4B1 PE=1 SV=1 263 488 2.0E-07
sp|Q9LTM0|C71BN_ARATH Cytochrome P450 71B23 OS=Arabidopsis thaliana GN=CYP71B23 PE=2 SV=1 181 495 2.0E-07
sp|Q64654|CP51A_RAT Lanosterol 14-alpha demethylase OS=Rattus norvegicus GN=Cyp51a1 PE=2 SV=1 230 520 2.0E-07
sp|Q3MID2|CP4F3_RAT Leukotriene-B(4) omega-hydroxylase 2 OS=Rattus norvegicus GN=Cyp4f3 PE=2 SV=1 312 486 2.0E-07
sp|O22307|C71DB_LOTJA Cytochrome P450 71D11 (Fragment) OS=Lotus japonicus GN=CYP71D11 PE=2 SV=1 285 493 2.0E-07
sp|Q4PJW3|CP51A_BOVIN Lanosterol 14-alpha demethylase OS=Bos taurus GN=CYP51A1 PE=2 SV=1 230 521 2.0E-07
sp|P20817|CP4AE_RAT Cytochrome P450 4A14 OS=Rattus norvegicus GN=Cyp4a14 PE=1 SV=2 282 488 2.0E-07
sp|G3V7X8|CP26B_RAT Cytochrome P450 26B1 OS=Rattus norvegicus GN=Cyp26b1 PE=2 SV=1 267 482 2.0E-07
sp|O64635|C76C4_ARATH Cytochrome P450 76C4 OS=Arabidopsis thaliana GN=CYP76C4 PE=3 SV=1 282 493 2.0E-07
sp|Q86W10|CP4Z1_HUMAN Cytochrome P450 4Z1 OS=Homo sapiens GN=CYP4Z1 PE=2 SV=1 282 497 2.0E-07
sp|O64637|C76C2_ARATH Cytochrome P450 76C2 OS=Arabidopsis thaliana GN=CYP76C2 PE=2 SV=1 250 493 2.0E-07
sp|Q9LTL2|C71BP_ARATH Cytochrome P450 71B25 OS=Arabidopsis thaliana GN=CYP71B25 PE=2 SV=1 277 491 3.0E-07
sp|Q60991|CP7B1_MOUSE 25-hydroxycholesterol 7-alpha-hydroxylase OS=Mus musculus GN=Cyp7b1 PE=2 SV=2 283 489 3.0E-07
sp|P33268|CP3A8_MACFA Cytochrome P450 3A8 OS=Macaca fascicularis GN=CYP3A8 PE=1 SV=1 266 521 3.0E-07
sp|Q9K498|EIZFM_STRCO Epi-isozizaene 5-monooxygenase/(E)-beta-farnesene synthase OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=SCO5223 PE=1 SV=1 226 507 3.0E-07
sp|P20816|CP4A2_RAT Cytochrome P450 4A2 OS=Rattus norvegicus GN=Cyp4a2 PE=1 SV=2 282 488 3.0E-07
sp|Q9VE00|C12A4_DROME Probable cytochrome P450 12a4, mitochondrial OS=Drosophila melanogaster GN=Cyp12a4 PE=2 SV=2 244 495 3.0E-07
sp|Q8VWZ7|C76B6_CATRO Geraniol 8-hydroxylase OS=Catharanthus roseus GN=CYP76B6 PE=1 SV=1 237 504 4.0E-07
sp|Q9VJ71|CP310_DROME Probable cytochrome P450 310a1 OS=Drosophila melanogaster GN=Cyp310a1 PE=2 SV=1 313 526 4.0E-07
sp|Q08477|CP4F3_HUMAN Docosahexaenoic acid omega-hydroxylase CYP4F3 OS=Homo sapiens GN=CYP4F3 PE=1 SV=2 312 486 4.0E-07
sp|Q9NR63|CP26B_HUMAN Cytochrome P450 26B1 OS=Homo sapiens GN=CYP26B1 PE=1 SV=1 267 482 5.0E-07
sp|Q9V979|CP6U1_DROME Probable cytochrome P450 6u1 OS=Drosophila melanogaster GN=Cyp6u1 PE=2 SV=3 284 498 5.0E-07
sp|Q55AJ4|C516B_DICDI Probable cytochrome P450 516B1 OS=Dictyostelium discoideum GN=cyp516B1 PE=3 SV=1 276 520 5.0E-07
sp|P37124|C77A2_SOLME Cytochrome P450 77A2 OS=Solanum melongena GN=CYP77A2 PE=2 SV=1 237 522 5.0E-07
sp|Q64406|CP3AF_CAVPO Cytochrome P450 3A15 OS=Cavia porcellus GN=CYP3A15 PE=2 SV=1 282 517 5.0E-07
sp|Q9EP75|CP4FE_MOUSE Leukotriene-B4 omega-hydroxylase 3 OS=Mus musculus GN=Cyp4f14 PE=1 SV=1 312 486 5.0E-07
sp|O15528|CP27B_HUMAN 25-hydroxyvitamin D-1 alpha hydroxylase, mitochondrial OS=Homo sapiens GN=CYP27B1 PE=1 SV=1 222 502 6.0E-07
sp|Q12609|STCF_EMENI Probable sterigmatocystin biosynthesis P450 monooxygenase stcF OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=stcF PE=3 SV=3 310 489 6.0E-07
sp|Q9HBI6|CP4FB_HUMAN Phylloquinone omega-hydroxylase CYP4F11 OS=Homo sapiens GN=CYP4F11 PE=1 SV=3 312 486 6.0E-07
sp|D5JBX0|GAO_HELAN Germacrene A oxidase OS=Helianthus annuus PE=1 SV=1 314 495 6.0E-07
sp|Q42799|C93A2_SOYBN Cytochrome P450 93A2 OS=Glycine max GN=CYP93A2 PE=2 SV=1 282 496 7.0E-07
sp|D5JBW8|GAO_CICIN Germacrene A oxidase OS=Cichorium intybus PE=1 SV=1 314 495 7.0E-07
sp|Q27589|CP4D2_DROME Cytochrome P450 4d2 OS=Drosophila melanogaster GN=Cyp4d2 PE=2 SV=2 281 488 8.0E-07
sp|O35132|CP27B_RAT 25-hydroxyvitamin D-1 alpha hydroxylase, mitochondrial OS=Rattus norvegicus GN=Cyp27b1 PE=2 SV=2 312 502 8.0E-07
sp|B9X287|C7346_ORYSJ Cytochrome P450 734A6 OS=Oryza sativa subsp. japonica GN=CYP734A6 PE=2 SV=1 245 516 8.0E-07
sp|P11707|CP3A6_RABIT Cytochrome P450 3A6 OS=Oryctolagus cuniculus GN=CYP3A6 PE=2 SV=2 282 517 9.0E-07
sp|Q9CX98|CP2U1_MOUSE Cytochrome P450 2U1 OS=Mus musculus GN=Cyp2u1 PE=2 SV=2 265 498 9.0E-07
sp|Q6YTF1|C76M8_ORYSJ Oryzalexin D synthase OS=Oryza sativa subsp. japonica GN=CYP76M8 PE=1 SV=1 233 495 1.0E-06
sp|Q964R1|CP6J1_BLAGE Cytochrome P450 6j1 OS=Blattella germanica GN=CYP6J1 PE=2 SV=1 279 487 1.0E-06
sp|O48923|C71DA_SOYBN Cytochrome P450 71D10 OS=Glycine max GN=CYP71D10 PE=2 SV=1 249 491 1.0E-06
sp|P49430|THAS_RAT Thromboxane-A synthase OS=Rattus norvegicus GN=Tbxas1 PE=2 SV=1 307 489 1.0E-06
sp|E1B2Z9|C7AV8_CICIN Cytochrome P450 71AV8 OS=Cichorium intybus GN=CYP71AV8 PE=2 SV=1 314 495 1.0E-06
sp|Q29552|C11B1_PIG Cytochrome P450 11B1, mitochondrial OS=Sus scrofa GN=CYP11B1 PE=2 SV=1 312 489 1.0E-06
sp|Q9SCN2|C71BU_ARATH Cytochrome P450 71B31 OS=Arabidopsis thaliana GN=CYP71B31 PE=2 SV=1 282 495 1.0E-06
sp|P79401|CP3AT_PIG Cytochrome P450 3A29 OS=Sus scrofa GN=CYP3A29 PE=2 SV=1 282 489 1.0E-06
sp|D5JBW9|GAO_SAUCO Germacrene A oxidase OS=Saussurea costus PE=1 SV=1 314 495 1.0E-06
sp|O48921|C97B2_SOYBN Cytochrome P450 97B2, chloroplastic OS=Glycine max GN=CYP97B2 PE=2 SV=1 231 521 1.0E-06
sp|Q9XHE8|C71DI_MENSP Cytochrome P450 71D18 OS=Mentha spicata GN=CYP71D18 PE=1 SV=1 311 493 1.0E-06
sp|Q6WKZ1|C71DI_MENGR Cytochrome P450 71D18 OS=Mentha gracilis GN=CYP71D18 PE=1 SV=1 311 493 1.0E-06
sp|G4XV71|C93C2_GLYUR 2-hydroxyisoflavanone synthase OS=Glycyrrhiza uralensis GN=CYP93C2 PE=2 SV=2 317 488 1.0E-06
sp|Q99N16|CP4F3_MOUSE Leukotriene-B(4) omega-hydroxylase 2 OS=Mus musculus GN=Cyp4f3 PE=1 SV=2 265 486 1.0E-06
sp|Q8K0C4|CP51A_MOUSE Lanosterol 14-alpha demethylase OS=Mus musculus GN=Cyp51a1 PE=1 SV=1 230 520 1.0E-06
sp|D5JBX1|GAO_BARSP Germacrene A oxidase OS=Barnadesia spinosa PE=1 SV=1 314 494 2.0E-06
sp|Q69XM6|C7344_ORYSJ Cytochrome P450 734A4 OS=Oryza sativa subsp. japonica GN=CYP734A4 PE=2 SV=1 281 488 2.0E-06
sp|Q6V0L0|CP26C_HUMAN Cytochrome P450 26C1 OS=Homo sapiens GN=CYP26C1 PE=2 SV=2 279 492 2.0E-06
sp|P10614|CP51_YEAST Lanosterol 14-alpha demethylase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ERG11 PE=1 SV=1 278 497 2.0E-06
sp|Q9STL1|C71AM_ARATH Cytochrome P450 71A22 OS=Arabidopsis thaliana GN=CYP71A22 PE=2 SV=1 155 491 2.0E-06
sp|P46634|CP7A1_CRIGR Cholesterol 7-alpha-monooxygenase OS=Cricetulus griseus GN=CYP7A1 PE=3 SV=1 317 489 2.0E-06
sp|Q08D50|CP26B_XENTR Cytochrome P450 26B1 OS=Xenopus tropicalis GN=cyp26b1 PE=2 SV=1 282 482 2.0E-06
sp|Q9GQM9|CP6L1_BLAGE Cytochrome P450 6l1 OS=Blattella germanica GN=CYP6L1 PE=2 SV=1 282 483 2.0E-06
sp|O65788|C71B2_ARATH Cytochrome P450 71B2 OS=Arabidopsis thaliana GN=CYP71B2 PE=2 SV=2 276 494 3.0E-06
sp|P48418|C75A1_PETHY Flavonoid 3',5'-hydroxylase 1 OS=Petunia hybrida GN=CYP75A1 PE=2 SV=1 282 504 3.0E-06
sp|P51663|C11B1_SHEEP Cytochrome P450 11B1, mitochondrial OS=Ovis aries GN=CYP11B1 PE=2 SV=2 312 489 3.0E-06
sp|O64989|C90B1_ARATH Cytochrome P450 90B1 OS=Arabidopsis thaliana GN=CYP90B1 PE=1 SV=2 308 520 3.0E-06
sp|Q9VYY4|C4G15_DROME Cytochrome P450 4g15 OS=Drosophila melanogaster GN=Cyp4g15 PE=2 SV=1 307 486 4.0E-06
sp|Q7Y1V5|C78AB_ORYSJ Cytochrome P450 78A11 OS=Oryza sativa subsp. japonica GN=CYP78A11 PE=1 SV=2 282 514 5.0E-06
sp|Q42798|C93A1_SOYBN 3,9-dihydroxypterocarpan 6A-monooxygenase OS=Glycine max GN=CYP93A1 PE=1 SV=1 259 496 5.0E-06
sp|P15150|C11B1_BOVIN Cytochrome P450 11B1, mitochondrial OS=Bos taurus GN=CYP11B1 PE=1 SV=2 312 489 5.0E-06
sp|Q9VFP1|CP6D5_DROME Probable cytochrome P450 6d5 OS=Drosophila melanogaster GN=Cyp6d5 PE=2 SV=1 143 489 5.0E-06
sp|Q64462|CP4B1_MOUSE Cytochrome P450 4B1 OS=Mus musculus GN=Cyp4b1 PE=1 SV=1 312 499 7.0E-06
sp|P79304|CP193_PIG Aromatase 3 OS=Sus scrofa GN=CYP19A3 PE=2 SV=2 79 493 8.0E-06
sp|Q07217|CP11A_ONCMY Cholesterol side-chain cleavage enzyme, mitochondrial OS=Oncorhynchus mykiss GN=cyp11a1 PE=2 SV=1 312 483 8.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005506 iron ion binding Yes
GO:0004497 monooxygenase activity Yes
GO:0016705 oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen Yes
GO:0020037 heme binding Yes
GO:0046914 transition metal ion binding No
GO:0046872 metal ion binding No
GO:0005488 binding No
GO:0097159 organic cyclic compound binding No
GO:0016491 oxidoreductase activity No
GO:0003824 catalytic activity No
GO:0046906 tetrapyrrole binding No
GO:0003674 molecular_function No
GO:0043169 cation binding No
GO:0043167 ion binding No
GO:1901363 heterocyclic compound binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 46 0.5

Transmembrane Domains

Domain # Start End Length
1 19 41 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
SC16a Pure fungal culture 0.02 0.00 0.20
CcL In ants, during behavior modification 118.18 7.32 229.03
CcD In ants, recently dead 0.09 0.00 0.36

Differential expression

Label1 Label2 Q-value Significant difference
SC16a CcL 0.203598 no
SC16a CcD 1.000000 no
CcL CcD 0.159128 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|2264
MNRSDMESLAWASQRYPYGIYWGQMLAALAIIGLCTWLFFPSTDTVSAPFIGSRWPWEPKFMTRLRFATGAQDII
NEGYSKCKDSSFRVSRTDGDVLVLSRKYLDELHNAPVQRLSSIKGLIKNFGGHYSGISLLGESDVGTRALQTKIT
PNLPKLVDDMRDELEHALRMEMPDCQDWTAVSMQPLLLKLLSSITQRVFIGLPLCRNQEWLDASSQHAHNVTMTQ
MAMRVVPPWMRPLLDLVLPSSWKYKACVRSGKKIIAPEVQRRRRLEETDPDYIKPDDLLQAMMDLSAPHEKQSQP
EDLAHRQLLMTLVAGHSTAAAGSHALFDLVARPDCLDELRREAVQVLQEEGGCWQKQSLGKLYKMDSVLRESQRM
NPPSLLGFHRIIQDPDGITLHDGLHVPYGTHVCIAPHSVSSDPAVIRQPDIFNGLRYFERRRENAAEASRHQHAT
ADKDHLHFGYGTWSCPGRFLASAELKMVLVELLLRYDFKYPAGSSRPVNRNIEEFPYVHVETPLLLRRRRRPAET
EAGL
Coding >Ophio5|2264
ATGAACCGCAGTGACATGGAATCCCTGGCCTGGGCGTCCCAAAGATATCCGTATGGGATCTATTGGGGCCAAATG
CTTGCTGCTCTCGCCATCATCGGCCTTTGCACCTGGCTCTTCTTTCCCTCGACCGACACAGTCTCGGCTCCCTTC
ATCGGATCTCGCTGGCCATGGGAGCCCAAGTTCATGACTCGGCTCCGGTTCGCAACTGGAGCGCAAGACATCATC
AACGAGGGATACTCCAAGTGCAAGGATTCGAGTTTTCGAGTCTCGCGGACCGACGGCGACGTGCTGGTGCTTTCA
CGCAAGTATCTGGATGAGTTGCACAACGCCCCTGTTCAGCGACTGAGCTCCATCAAGGGTTTGATCAAGAATTTC
GGCGGCCACTATAGCGGCATCAGCCTCCTCGGCGAAAGTGATGTGGGAACTCGCGCCCTTCAGACGAAAATCACG
CCTAATCTTCCCAAACTGGTCGACGATATGAGAGACGAACTCGAACACGCCTTGCGGATGGAGATGCCTGACTGT
CAAGACTGGACGGCCGTTTCCATGCAGCCTCTGCTGCTCAAACTCCTGAGTAGCATCACGCAACGCGTCTTCATC
GGCTTACCCCTCTGTCGCAACCAAGAGTGGCTCGACGCATCCTCTCAGCATGCTCATAATGTCACCATGACCCAG
ATGGCCATGCGAGTCGTTCCGCCTTGGATGAGACCCTTACTCGATCTCGTACTTCCATCTTCTTGGAAGTACAAG
GCCTGTGTCCGTAGCGGCAAGAAGATTATCGCGCCCGAAGTCCAGCGAAGGCGTCGTCTGGAGGAAACGGATCCG
GACTACATCAAGCCCGACGACCTGCTGCAGGCCATGATGGACCTCTCCGCCCCTCATGAGAAGCAAAGCCAGCCC
GAGGATCTAGCCCACCGGCAACTTCTGATGACCCTCGTCGCGGGCCATAGTACTGCCGCAGCCGGGTCGCATGCC
CTCTTCGATCTCGTGGCCCGGCCTGATTGCTTGGACGAGTTGCGCCGCGAGGCTGTCCAGGTGCTGCAGGAGGAG
GGCGGCTGCTGGCAGAAACAGTCGCTGGGCAAGCTGTACAAGATGGACAGTGTCCTGAGAGAGTCTCAGAGAATG
AATCCTCCCAGTTTGTTGGGCTTCCATCGTATTATCCAGGATCCTGACGGCATCACTCTCCACGATGGCCTGCAC
GTCCCCTACGGCACCCACGTCTGCATTGCACCGCACTCCGTCTCCAGCGACCCGGCCGTGATCCGCCAGCCAGAT
ATCTTCAACGGACTCCGCTACTTCGAGAGACGGCGTGAGAACGCAGCGGAAGCCTCACGACACCAGCACGCAACC
GCCGACAAGGACCACCTGCACTTCGGCTACGGCACATGGTCCTGTCCCGGCCGCTTCCTCGCTTCGGCCGAGCTC
AAGATGGTTCTAGTGGAGCTGCTGCTTCGGTACGACTTCAAGTATCCCGCGGGAAGCTCAAGGCCGGTAAACCGA
AACATCGAGGAGTTTCCGTATGTCCATGTCGAAACGCCACTGCTGCTTCGCCGTCGTCGCCGTCCCGCTGAGACG
GAGGCCGGGCTG
Transcript >Ophio5|2264
ATGAACCGCAGTGACATGGAATCCCTGGCCTGGGCGTCCCAAAGATATCCGTATGGGATCTATTGGGGCCAAATG
CTTGCTGCTCTCGCCATCATCGGCCTTTGCACCTGGCTCTTCTTTCCCTCGACCGACACAGTCTCGGCTCCCTTC
ATCGGATCTCGCTGGCCATGGGAGCCCAAGTTCATGACTCGGCTCCGGTTCGCAACTGGAGCGCAAGACATCATC
AACGAGGGATACTCCAAGTGCAAGGATTCGAGTTTTCGAGTCTCGCGGACCGACGGCGACGTGCTGGTGCTTTCA
CGCAAGTATCTGGATGAGTTGCACAACGCCCCTGTTCAGCGACTGAGCTCCATCAAGGGTTTGATCAAGAATTTC
GGCGGCCACTATAGCGGCATCAGCCTCCTCGGCGAAAGTGATGTGGGAACTCGCGCCCTTCAGACGAAAATCACG
CCTAATCTTCCCAAACTGGTCGACGATATGAGAGACGAACTCGAACACGCCTTGCGGATGGAGATGCCTGACTGT
CAAGACTGGACGGCCGTTTCCATGCAGCCTCTGCTGCTCAAACTCCTGAGTAGCATCACGCAACGCGTCTTCATC
GGCTTACCCCTCTGTCGCAACCAAGAGTGGCTCGACGCATCCTCTCAGCATGCTCATAATGTCACCATGACCCAG
ATGGCCATGCGAGTCGTTCCGCCTTGGATGAGACCCTTACTCGATCTCGTACTTCCATCTTCTTGGAAGTACAAG
GCCTGTGTCCGTAGCGGCAAGAAGATTATCGCGCCCGAAGTCCAGCGAAGGCGTCGTCTGGAGGAAACGGATCCG
GACTACATCAAGCCCGACGACCTGCTGCAGGCCATGATGGACCTCTCCGCCCCTCATGAGAAGCAAAGCCAGCCC
GAGGATCTAGCCCACCGGCAACTTCTGATGACCCTCGTCGCGGGCCATAGTACTGCCGCAGCCGGGTCGCATGCC
CTCTTCGATCTCGTGGCCCGGCCTGATTGCTTGGACGAGTTGCGCCGCGAGGCTGTCCAGGTGCTGCAGGAGGAG
GGCGGCTGCTGGCAGAAACAGTCGCTGGGCAAGCTGTACAAGATGGACAGTGTCCTGAGAGAGTCTCAGAGAATG
AATCCTCCCAGTTTGTTGGGCTTCCATCGTATTATCCAGGATCCTGACGGCATCACTCTCCACGATGGCCTGCAC
GTCCCCTACGGCACCCACGTCTGCATTGCACCGCACTCCGTCTCCAGCGACCCGGCCGTGATCCGCCAGCCAGAT
ATCTTCAACGGACTCCGCTACTTCGAGAGACGGCGTGAGAACGCAGCGGAAGCCTCACGACACCAGCACGCAACC
GCCGACAAGGACCACCTGCACTTCGGCTACGGCACATGGTCCTGTCCCGGCCGCTTCCTCGCTTCGGCCGAGCTC
AAGATGGTTCTAGTGGAGCTGCTGCTTCGGTACGACTTCAAGTATCCCGCGGGAAGCTCAAGGCCGGTAAACCGA
AACATCGAGGAGTTTCCGTATGTCCATGTCGAAACGCCACTGCTGCTTCGCCGTCGTCGCCGTCCCGCTGAGACG
GAGGCCGGGCTGTAG
Gene >Ophio5|2264
ATGAACCGCAGTGACATGGAATCCCTGGCCTGGGCGTCCCAAAGATATCCGTATGGGATCTATTGGGGCCAAATG
CTTGCTGCTCTCGCCATCATCGGCCTTTGCACCTGGCTCTTCTTTCCCTCGACCGACACAGTCTCGGCTCCCTTC
ATCGGATCTCGCTGGCCATGGGAGCCCAAGTTCATGACTCGGCTCCGGTTCGCAACTGGAGCGCAAGACATCATC
AACGAGGGATACTCCAAGGCAAGTCGTCTTCTTTACCGAAACATGGAAACTGCTTCTCATGGCTACGCAGTGCAA
GGATTCGAGTTTTCGAGTCTCGCGGACCGACGGCGACGTGCTGGTGCTTTCACGCAAGTATCTGGATGAGTTGCA
CAACGCCCCTGTTCAGCGACTGAGCTCCATCAAGGGTTTGATCAAGGTGAAGGATTCAACCACTGGCAAGTGAGA
GCTTCGTTCCTTTTGTTGATCGTGAATCGCAGAATTTCGGCGGCCACTATAGCGGCATCAGCCTCCTCGGCGAAA
GTGATGTGGGAACTCGCGCCCTTCAGGTTCGTACAGCCGCATCTGGAGAAAGACCAAGTGTTTTGTCTGTCTGTC
CTGGAGTTGACGGCAATAAACCAAGACGAAAATCACGCCTAATCTTCCCAAACTGGTCGACGATATGAGAGACGA
ACTCGAACACGCCTTGCGGATGGAGATGCCTGACTGTCAAGGTGTGTATTAATTACCTAGGTCTCTCCTTTTCTA
TCCTATCGCCAGGTGTCCAGAGTATTGCTTATACTCAAGGGTGTATAGACTGGACGGCCGTTTCCATGCAGCCTC
TGCTGCTCAAACTCCTGAGTAGCATCACGCAACGCGTCTTCATCGGCTTACCCCTCTGTCGCAACCAAGAGTGGC
TCGACGCATCCTCTCAGCATGCTCATAATGGTGAGGCCAATGCTCAGGCCGAAGAGATTCCATCTGTCCAGGTAC
TGACGCCGGAAACTCAAACAGTCACCATGACCCAGATGGCCATGCGAGTCGTTCCGCCTTGGATGAGACCCTTAC
TCGATCTCGTACTTCCATCTTCTTGGAAGTACAAGGCCTGTGTCCGTAGCGGCAAGAAGATTATCGCGCCCGAAG
TCCAGCGAAGGCGTCGTCTGGAGGAAACGGATCCGGACTACATCAAGCCCGACGACCTGCTGCAGGCCATGATGG
ACCTCTCCGCCCCTCATGAGAAGCAAAGCCAGCCCGAGGATCTAGCCCACCGGCAACTTCTGATGACCCTCGTCG
CGGGCCATAGTACTGCCGCAGCCGGGTCGCATGCCCTCTTCGATCTCGTGGCCCGGCCTGATTGCTTGGACGAGT
TGCGCCGCGAGGCTGTCCAGGTGCTGCAGGAGGAGGGCGGCTGCTGGCAGAAACAGTCGCTGGGCAAGCTGTACA
AGATGGACAGTGTCCTGAGAGAGTGAGAGAGTGCGTCCTCTGGTCTGCTCATGAGCTGATTGTCTTGTCCATCTA
GGTCTCAGAGAATGAATCCTCCCAGTTTGTGTAAGCATTCAACCTTATTGCCTCCTTCAGACAAGGCCACACTGA
CCGGCTTCAGTGGGCTTCCATCGTATTATCCAGGATCCTGACGGCATCACTCTCCACGATGGCCTGCACGTCCCC
TACGGCACCCACGTCTGCATTGCACCGCACTCCGTCTCCAGCGACCCGGCCGTGATCCGCCAGCCAGATATCTTC
AACGGACTCCGCTACTTCGAGAGACGGCGTGAGAACGCAGCGGAAGCCTCACGACACCAGCACGCAACCGCCGAC
AAGGACCACCTGCACTTCGGCTACGGCACATGGTCCTGTCCCGGCCGCTTCCTCGCTTCGGCCGAGCTCAAGATG
GTTCTAGTGGAGCTGCTGCTTCGGTACGACTTCAAGTATCCCGCGGGAAGCTCAAGGCCGGTAAACCGAAACATC
GAGGAGTTTCCGTATGTCCATGTCGAAACGCCACTGCTGCTTCGCCGTCGTCGCCGTCCCGCTGAGACGGAGGCC
GGGCTGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail