Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|2262
Gene name
Locationscaffold_1933:210..837
Strand+
Gene length (bp)627
Transcript length (bp)573
Coding sequence length (bp)570
Protein length (aa) 190

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family 1.2E-12 29 135
PF13673 Acetyltransf_10 Acetyltransferase (GNAT) domain 4.5E-09 43 138
PF13508 Acetyltransf_7 Acetyltransferase (GNAT) domain 1.8E-08 42 136
PF08445 FR47 FR47-like protein 2.2E-05 80 138

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q58ED9|NAA20_DANRE N-alpha-acetyltransferase 20 OS=Danio rerio GN=naa20 PE=2 SV=1 1 189 3.0E-52
sp|Q7ZXR3|NAA20_XENLA N-alpha-acetyltransferase 20 OS=Xenopus laevis GN=naa20 PE=2 SV=1 1 189 4.0E-52
sp|P61600|NAA20_MOUSE N-alpha-acetyltransferase 20 OS=Mus musculus GN=Naa20 PE=1 SV=1 1 189 5.0E-52
sp|Q2PFM2|NAA20_MACFA N-alpha-acetyltransferase 20 OS=Macaca fascicularis GN=NAA20 PE=2 SV=1 1 189 5.0E-52
sp|P61599|NAA20_HUMAN N-alpha-acetyltransferase 20 OS=Homo sapiens GN=NAA20 PE=1 SV=1 1 189 5.0E-52
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q58ED9|NAA20_DANRE N-alpha-acetyltransferase 20 OS=Danio rerio GN=naa20 PE=2 SV=1 1 189 3.0E-52
sp|Q7ZXR3|NAA20_XENLA N-alpha-acetyltransferase 20 OS=Xenopus laevis GN=naa20 PE=2 SV=1 1 189 4.0E-52
sp|P61600|NAA20_MOUSE N-alpha-acetyltransferase 20 OS=Mus musculus GN=Naa20 PE=1 SV=1 1 189 5.0E-52
sp|Q2PFM2|NAA20_MACFA N-alpha-acetyltransferase 20 OS=Macaca fascicularis GN=NAA20 PE=2 SV=1 1 189 5.0E-52
sp|P61599|NAA20_HUMAN N-alpha-acetyltransferase 20 OS=Homo sapiens GN=NAA20 PE=1 SV=1 1 189 5.0E-52
sp|Q6P632|NAA20_XENTR N-alpha-acetyltransferase 20 OS=Xenopus tropicalis GN=naa20 PE=2 SV=1 1 189 1.0E-51
sp|O74457|NAT3_SCHPO N-terminal acetyltransferase B complex catalytic subunit naa20 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=naa20 PE=3 SV=1 1 190 3.0E-50
sp|Q8SSN5|NAA20_DICDI N-alpha-acetyltransferase 20 OS=Dictyostelium discoideum GN=nat5 PE=3 SV=2 1 175 5.0E-45
sp|Q05885|ARD1_LEIDO N-terminal acetyltransferase complex ARD1 subunit homolog OS=Leishmania donovani GN=ARD1 PE=3 SV=1 1 189 2.0E-36
sp|Q06504|NAT3_YEAST N-terminal acetyltransferase B complex catalytic subunit NAT3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NAT3 PE=1 SV=2 1 189 3.0E-32
sp|Q9BSU3|NAA11_HUMAN N-alpha-acetyltransferase 11 OS=Homo sapiens GN=NAA11 PE=1 SV=3 3 173 2.0E-22
sp|Q9QY36|NAA10_MOUSE N-alpha-acetyltransferase 10 OS=Mus musculus GN=Naa10 PE=1 SV=1 3 173 2.0E-21
sp|P41227|NAA10_HUMAN N-alpha-acetyltransferase 10 OS=Homo sapiens GN=NAA10 PE=1 SV=1 3 173 2.0E-21
sp|Q2KI14|NAA10_BOVIN N-alpha-acetyltransferase 10 OS=Bos taurus GN=NAA10 PE=2 SV=1 3 173 2.0E-21
sp|Q3UX61|NAA11_MOUSE N-alpha-acetyltransferase 11 OS=Mus musculus GN=Naa11 PE=1 SV=1 3 173 6.0E-21
sp|P36416|ARD1_DICDI N-terminal acetyltransferase complex ARD1 subunit homolog OS=Dictyostelium discoideum GN=natA PE=2 SV=1 1 147 7.0E-21
sp|Q4V8K3|NAA11_RAT N-alpha-acetyltransferase 11 OS=Rattus norvegicus GN=Naa11 PE=2 SV=1 3 173 1.0E-20
sp|Q9UTI3|ARD1_SCHPO N-terminal acetyltransferase A complex catalytic subunit ard1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ard1 PE=1 SV=1 10 170 6.0E-20
sp|O61219|DAF31_CAEEL N-alpha-acetyltransferase daf-31 OS=Caenorhabditis elegans GN=daf-31 PE=2 SV=1 10 168 6.0E-18
sp|P07347|ARD1_YEAST N-terminal acetyltransferase A complex catalytic subunit ARD1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ARD1 PE=1 SV=2 4 167 4.0E-13
sp|Q976C3|Y258_SULTO Uncharacterized N-acetyltransferase STK_02580 OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=STK_02580 PE=3 SV=1 10 147 5.0E-13
sp|Q4JBG0|Y459_SULAC Uncharacterized N-acetyltransferase Saci_0459 OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=Saci_0459 PE=3 SV=1 10 147 2.0E-11
sp|Q980R9|Y209_SULSO Uncharacterized N-acetyltransferase SSO0209 OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=SSO0209 PE=1 SV=2 3 147 3.0E-10
[Show less]

GO

GO Term Description Terminal node
GO:0008080 N-acetyltransferase activity Yes
GO:0016747 acyltransferase activity, transferring groups other than amino-acyl groups Yes
GO:0016746 acyltransferase activity No
GO:0003824 catalytic activity No
GO:0016740 transferase activity No
GO:0016410 N-acyltransferase activity No
GO:0003674 molecular_function No
GO:0016407 acetyltransferase activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 52 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|2262
MATFRRFEHNDVNKFSRCNLDPLTETYDVGFYLHYFAKWPSLFYVCEDANGNILGYVMGKVESSPDAYKYSKHYL
PWHAHITALTVAPEARRLGIGKILTELLEAAADANDAWFMDLFVRRSNQKAIAFYECLGYSVFRVVRDYYGDHAT
DPNQSSEDALDMRKAMKRDTHKMHIRANGIYYVVDPEDVS
Coding >Ophio5|2262
ATGGCCACCTTCCGTCGATTCGAACACAACGACGTCAATAAGTTTTCGAGATGCAATCTTGATCCCTTAACGGAA
ACCTACGATGTGGGCTTTTATCTGCATTACTTCGCTAAATGGCCATCGCTCTTTTATGTCTGCGAAGATGCGAAC
GGTAACATCTTGGGCTATGTCATGGGAAAGGTCGAGTCGTCCCCTGATGCGTACAAGTACTCAAAACACTACCTG
CCGTGGCATGCCCATATAACGGCTCTGACGGTCGCTCCCGAAGCTCGCCGACTAGGTATCGGCAAGATATTGACT
GAACTACTCGAAGCTGCTGCCGACGCCAACGATGCCTGGTTCATGGACCTCTTCGTCCGCAGGAGTAATCAGAAA
GCTATCGCCTTCTACGAGTGCCTGGGATACAGCGTGTTCCGTGTCGTAAGGGATTACTATGGTGATCATGCTACA
GACCCGAACCAGAGTAGCGAAGATGCCCTCGATATGAGAAAAGCGATGAAGAGAGACACCCATAAGATGCATATT
AGAGCTAATGGCATCTACTACGTAGTCGACCCTGAAGACGTTTCA
Transcript >Ophio5|2262
ATGGCCACCTTCCGTCGATTCGAACACAACGACGTCAATAAGTTTTCGAGATGCAATCTTGATCCCTTAACGGAA
ACCTACGATGTGGGCTTTTATCTGCATTACTTCGCTAAATGGCCATCGCTCTTTTATGTCTGCGAAGATGCGAAC
GGTAACATCTTGGGCTATGTCATGGGAAAGGTCGAGTCGTCCCCTGATGCGTACAAGTACTCAAAACACTACCTG
CCGTGGCATGCCCATATAACGGCTCTGACGGTCGCTCCCGAAGCTCGCCGACTAGGTATCGGCAAGATATTGACT
GAACTACTCGAAGCTGCTGCCGACGCCAACGATGCCTGGTTCATGGACCTCTTCGTCCGCAGGAGTAATCAGAAA
GCTATCGCCTTCTACGAGTGCCTGGGATACAGCGTGTTCCGTGTCGTAAGGGATTACTATGGTGATCATGCTACA
GACCCGAACCAGAGTAGCGAAGATGCCCTCGATATGAGAAAAGCGATGAAGAGAGACACCCATAAGATGCATATT
AGAGCTAATGGCATCTACTACGTAGTCGACCCTGAAGACGTTTCATAA
Gene >Ophio5|2262
ATGGCCACCTTCCGTCGATTCGAACACAACGACGTCAATAAGTTTTCGAGATGCAATCTTGATCCCTTAACGGAA
ACCTACGATGTGGGCTTTTATCTGCATTACTTCGCTAAATGGCCATCGCTCTTTTATGTCTGCGAAGATGCGAAC
GGTAACATCTTGGGCTATGGTCAGTGGCTCTCTATACGGTGTTATCTGCAACAGTGAAATTAATGAACCATAGTC
ATGGGAAAGGTCGAGTCGTCCCCTGATGCGTACAAGTACTCAAAACACTACCTGCCGTGGCATGCCCATATAACG
GCTCTGACGGTCGCTCCCGAAGCTCGCCGACTAGGTATCGGCAAGATATTGACTGAACTACTCGAAGCTGCTGCC
GACGCCAACGATGCCTGGTTCATGGACCTCTTCGTCCGCAGGAGTAATCAGAAAGCTATCGCCTTCTACGAGTGC
CTGGGATACAGCGTGTTCCGTGTCGTAAGGGATTACTATGGTGATCATGCTACAGACCCGAACCAGAGTAGCGAA
GATGCCCTCGATATGAGAAAAGCGATGAAGAGAGACACCCATAAGATGCATATTAGAGCTAATGGCATCTACTAC
GTAGTCGACCCTGAAGACGTTTCATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail