Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|2260
Gene name
Locationscaffold_193:28958..29832
Strand-
Gene length (bp)874
Transcript length (bp)798
Coding sequence length (bp)795
Protein length (aa) 265

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF20354 DUF6649 Family of unknown function (DUF6649) 1.1E-23 67 225

Swissprot hits

(None)

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus Nuclear localization signal 0.3114 0.9467 0.0664 0.0155 0.0733 0.0005 0.0405 0.0138 0.0072 0.0217

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup5885
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2753
Ophiocordyceps australis map64 (Brazil) OphauB2|4428
Ophiocordyceps camponoti-floridani Ophcf2|03369
Ophiocordyceps camponoti-rufipedis Ophun1|584
Ophiocordyceps kimflemingae Ophio5|2260 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|2260
MVRGDAAAAAALQQQPGQQHQQHQHQQQDALQGPLQGSLQHPFQLSSPPGGHPHAAAPSRKRKAAPHEGERRLSK
RLSLLNLERSGSKLYVPVETPPPFTSTSSPSPPLSLSHSHGGGNDDDDDDDDDMMQLDDSKHKVYIYNMDDDLSS
DSEPDDGRLVFLPDIDRHLRQRRIPPSVLANPEGELAGMQMVLYNDPRSLTVPEDRDGVRRAILDARQRLRERQR
RERDEERDEERDEARARCDADMDSVDADAMDVDMCSRECC
Coding >Ophio5|2260
ATGGTTCGGGGGGATGCGGCGGCGGCGGCGGCGCTACAGCAGCAGCCCGGCCAGCAGCACCAGCAGCACCAGCAC
CAGCAACAAGATGCGCTACAGGGACCGCTGCAGGGGTCGCTACAGCATCCCTTCCAGCTGTCGTCGCCCCCGGGC
GGGCATCCCCATGCAGCTGCTCCCTCCCGCAAGCGCAAAGCCGCACCGCACGAAGGCGAACGGCGACTGTCGAAG
CGCCTCAGCCTCCTCAATCTCGAACGTAGCGGCTCTAAGCTCTACGTCCCCGTCGAGACGCCGCCACCGTTTACT
TCGACTTCTTCGCCCTCTCCCCCTCTTTCACTGTCTCATAGCCATGGCGGCGGCAACGACGACGACGACGACGAC
GACGACGACATGATGCAGCTCGATGATTCCAAGCACAAAGTCTACATCTATAACATGGACGACGACCTCTCCTCC
GACAGCGAGCCCGACGACGGCCGTCTCGTCTTCCTCCCCGACATCGACCGTCACCTCCGCCAGAGGCGCATCCCG
CCCAGTGTGCTGGCCAACCCGGAAGGCGAGCTCGCCGGCATGCAGATGGTGCTCTACAACGACCCGCGGTCGCTG
ACGGTGCCCGAGGATCGCGATGGCGTTCGGAGAGCCATTCTCGATGCCAGGCAGCGTCTGAGGGAGAGGCAGAGG
CGGGAGAGGGATGAGGAGAGGGATGAGGAGAGGGACGAGGCCCGTGCGAGATGCGATGCCGACATGGACTCCGTC
GATGCCGACGCCATGGACGTTGACATGTGCTCACGCGAATGCTGT
Transcript >Ophio5|2260
ATGGTTCGGGGGGATGCGGCGGCGGCGGCGGCGCTACAGCAGCAGCCCGGCCAGCAGCACCAGCAGCACCAGCAC
CAGCAACAAGATGCGCTACAGGGACCGCTGCAGGGGTCGCTACAGCATCCCTTCCAGCTGTCGTCGCCCCCGGGC
GGGCATCCCCATGCAGCTGCTCCCTCCCGCAAGCGCAAAGCCGCACCGCACGAAGGCGAACGGCGACTGTCGAAG
CGCCTCAGCCTCCTCAATCTCGAACGTAGCGGCTCTAAGCTCTACGTCCCCGTCGAGACGCCGCCACCGTTTACT
TCGACTTCTTCGCCCTCTCCCCCTCTTTCACTGTCTCATAGCCATGGCGGCGGCAACGACGACGACGACGACGAC
GACGACGACATGATGCAGCTCGATGATTCCAAGCACAAAGTCTACATCTATAACATGGACGACGACCTCTCCTCC
GACAGCGAGCCCGACGACGGCCGTCTCGTCTTCCTCCCCGACATCGACCGTCACCTCCGCCAGAGGCGCATCCCG
CCCAGTGTGCTGGCCAACCCGGAAGGCGAGCTCGCCGGCATGCAGATGGTGCTCTACAACGACCCGCGGTCGCTG
ACGGTGCCCGAGGATCGCGATGGCGTTCGGAGAGCCATTCTCGATGCCAGGCAGCGTCTGAGGGAGAGGCAGAGG
CGGGAGAGGGATGAGGAGAGGGATGAGGAGAGGGACGAGGCCCGTGCGAGATGCGATGCCGACATGGACTCCGTC
GATGCCGACGCCATGGACGTTGACATGTGCTCACGCGAATGCTGTTGA
Gene >Ophio5|2260
ATGGTTCGGGGGGATGCGGCGGCGGCGGCGGCGCTACAGCAGCAGCCCGGCCAGCAGCACCAGCAGCACCAGCAC
CAGCAACAAGATGCGCTACAGGGACCGCTGCAGGGGTCGCTACAGCATCCCTTCCAGCTGTCGTCGCCCCCGGGC
GGGCATCCCCATGCAGCTGCTCCCTCCCGCAAGCGCAAAGCCGCACCGCACGAAGGCGAACGGCGACTGTCGAAG
CGCCTCAGCCTCCTCAATCTCGGTACCTTCTTCTTCCTCTTCATCCTCTTTCGTCTGGAAAATCTCATCCTCGCT
TACAATCTTGGTTTCGCGCTCAGAACGTAGCGGCTCTAAGCTCTACGTCCCCGTCGAGACGCCGCCACCGTTTAC
TTCGACTTCTTCGCCCTCTCCCCCTCTTTCACTGTCTCATAGCCATGGCGGCGGCAACGACGACGACGACGACGA
CGACGACGACATGATGCAGCTCGATGATTCCAAGCACAAAGTCTACATCTATAACATGGACGACGACCTCTCCTC
CGACAGCGAGCCCGACGACGGCCGTCTCGTCTTCCTCCCCGACATCGACCGTCACCTCCGCCAGAGGCGCATCCC
GCCCAGTGTGCTGGCCAACCCGGAAGGCGAGCTCGCCGGCATGCAGATGGTGCTCTACAACGACCCGCGGTCGCT
GACGGTGCCCGAGGATCGCGATGGCGTTCGGAGAGCCATTCTCGATGCCAGGCAGCGTCTGAGGGAGAGGCAGAG
GCGGGAGAGGGATGAGGAGAGGGATGAGGAGAGGGACGAGGCCCGTGCGAGATGCGATGCCGACATGGACTCCGT
CGATGCCGACGCCATGGACGTTGACATGTGCTCACGCGAATGCTGTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail