© 2023 - Robin Ohm - Utrecht University - The Netherlands
Built with Python Django and Wagtail
| Protein ID | Ophio5|2257 |
| Gene name | |
| Location | scaffold_193:22468..23761 |
| Strand | - |
| Gene length (bp) | 1293 |
| Transcript length (bp) | 1224 |
| Coding sequence length (bp) | 1221 |
| Protein length (aa) | 407 |
| PFAM Domain ID | Short name | Long name | E-value | Start | End |
|---|---|---|---|---|---|
| PF03167 | UDG | Uracil DNA glycosylase superfamily | 9.6E-23 | 167 | 325 |
| Swissprot ID | Swissprot Description | Start | End | E-value |
|---|---|---|---|---|
| sp|O74834|UNG_SCHPO | Uracil-DNA glycosylase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ung1 PE=3 SV=1 | 92 | 347 | 3.0E-96 |
| sp|P12887|UNG_YEAST | Uracil-DNA glycosylase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=UNG1 PE=1 SV=1 | 88 | 349 | 5.0E-84 |
| sp|Q182G9|UNG_PEPD6 | Uracil-DNA glycosylase OS=Peptoclostridium difficile (strain 630) GN=ung PE=3 SV=1 | 115 | 342 | 3.0E-69 |
| sp|A4IWI7|UNG_FRATW | Uracil-DNA glycosylase OS=Francisella tularensis subsp. tularensis (strain WY96-3418) GN=ung PE=3 SV=1 | 119 | 340 | 9.0E-66 |
| sp|Q5NEP2|UNG_FRATT | Uracil-DNA glycosylase OS=Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4) GN=ung PE=3 SV=1 | 119 | 340 | 9.0E-66 |
| Swissprot ID | Swissprot Description | Start | End | E-value |
|---|---|---|---|---|
| sp|O74834|UNG_SCHPO | Uracil-DNA glycosylase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ung1 PE=3 SV=1 | 92 | 347 | 3.0E-96 |
| sp|P12887|UNG_YEAST | Uracil-DNA glycosylase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=UNG1 PE=1 SV=1 | 88 | 349 | 5.0E-84 |
| sp|Q182G9|UNG_PEPD6 | Uracil-DNA glycosylase OS=Peptoclostridium difficile (strain 630) GN=ung PE=3 SV=1 | 115 | 342 | 3.0E-69 |
| sp|A4IWI7|UNG_FRATW | Uracil-DNA glycosylase OS=Francisella tularensis subsp. tularensis (strain WY96-3418) GN=ung PE=3 SV=1 | 119 | 340 | 9.0E-66 |
| sp|Q5NEP2|UNG_FRATT | Uracil-DNA glycosylase OS=Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4) GN=ung PE=3 SV=1 | 119 | 340 | 9.0E-66 |
| sp|B2SFW5|UNG_FRATM | Uracil-DNA glycosylase OS=Francisella tularensis subsp. mediasiatica (strain FSC147) GN=ung PE=3 SV=1 | 119 | 340 | 9.0E-66 |
| sp|Q14G45|UNG_FRAT1 | Uracil-DNA glycosylase OS=Francisella tularensis subsp. tularensis (strain FSC 198) GN=ung PE=3 SV=1 | 119 | 340 | 9.0E-66 |
| sp|A8AD07|UNG_CITK8 | Uracil-DNA glycosylase OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=ung PE=3 SV=1 | 117 | 338 | 2.0E-65 |
| sp|Q6D208|UNG_PECAS | Uracil-DNA glycosylase OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=ung PE=3 SV=1 | 119 | 338 | 2.0E-65 |
| sp|Q0TEQ8|UNG_ECOL5 | Uracil-DNA glycosylase OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=ung PE=3 SV=1 | 119 | 338 | 2.0E-65 |
| sp|B7NRN6|UNG_ECO7I | Uracil-DNA glycosylase OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=ung PE=3 SV=1 | 119 | 338 | 2.0E-65 |
| sp|Q0BN28|UNG_FRATO | Uracil-DNA glycosylase OS=Francisella tularensis subsp. holarctica (strain OSU18) GN=ung PE=3 SV=1 | 119 | 340 | 3.0E-65 |
| sp|Q2A4Q4|UNG_FRATH | Uracil-DNA glycosylase OS=Francisella tularensis subsp. holarctica (strain LVS) GN=ung PE=3 SV=1 | 119 | 340 | 3.0E-65 |
| sp|A7NAN4|UNG_FRATF | Uracil-DNA glycosylase OS=Francisella tularensis subsp. holarctica (strain FTNF002-00 / FTA) GN=ung PE=3 SV=1 | 119 | 340 | 3.0E-65 |
| sp|Q1R8F2|UNG_ECOUT | Uracil-DNA glycosylase OS=Escherichia coli (strain UTI89 / UPEC) GN=ung PE=3 SV=1 | 119 | 338 | 5.0E-65 |
| sp|B1LP93|UNG_ECOSM | Uracil-DNA glycosylase OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=ung PE=3 SV=1 | 119 | 338 | 5.0E-65 |
| sp|A1AEB0|UNG_ECOK1 | Uracil-DNA glycosylase OS=Escherichia coli O1:K1 / APEC GN=ung PE=3 SV=1 | 119 | 338 | 5.0E-65 |
| sp|B7MIR5|UNG_ECO45 | Uracil-DNA glycosylase OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=ung PE=3 SV=1 | 119 | 338 | 5.0E-65 |
| sp|B7UH19|UNG_ECO27 | Uracil-DNA glycosylase OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=ung PE=3 SV=1 | 119 | 338 | 5.0E-65 |
| sp|A7ZQ25|UNG_ECO24 | Uracil-DNA glycosylase OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=ung PE=3 SV=1 | 119 | 338 | 5.0E-65 |
| sp|B7LUY5|UNG_ESCF3 | Uracil-DNA glycosylase OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=ung PE=3 SV=1 | 119 | 338 | 5.0E-65 |
| sp|A6TCJ2|UNG_KLEP7 | Uracil-DNA glycosylase OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=ung PE=3 SV=1 | 119 | 338 | 6.0E-65 |
| sp|B7MYL3|UNG_ECO81 | Uracil-DNA glycosylase OS=Escherichia coli O81 (strain ED1a) GN=ung PE=3 SV=1 | 119 | 338 | 7.0E-65 |
| sp|C6DC11|UNG_PECCP | Uracil-DNA glycosylase OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=ung PE=3 SV=1 | 119 | 338 | 7.0E-65 |
| sp|Q3YYT5|UNG_SHISS | Uracil-DNA glycosylase OS=Shigella sonnei (strain Ss046) GN=ung PE=3 SV=1 | 119 | 338 | 8.0E-65 |
| sp|Q31XQ4|UNG_SHIBS | Uracil-DNA glycosylase OS=Shigella boydii serotype 4 (strain Sb227) GN=ung PE=3 SV=1 | 119 | 338 | 8.0E-65 |
| sp|B2TYK1|UNG_SHIB3 | Uracil-DNA glycosylase OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=ung PE=3 SV=1 | 119 | 338 | 8.0E-65 |
| sp|B6I5F5|UNG_ECOSE | Uracil-DNA glycosylase OS=Escherichia coli (strain SE11) GN=ung PE=3 SV=1 | 119 | 338 | 8.0E-65 |
| sp|P12295|UNG_ECOLI | Uracil-DNA glycosylase OS=Escherichia coli (strain K12) GN=ung PE=1 SV=2 | 119 | 338 | 8.0E-65 |
| sp|B1IVP7|UNG_ECOLC | Uracil-DNA glycosylase OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=ung PE=3 SV=1 | 119 | 338 | 8.0E-65 |
| sp|A8A392|UNG_ECOHS | Uracil-DNA glycosylase OS=Escherichia coli O9:H4 (strain HS) GN=ung PE=3 SV=1 | 119 | 338 | 8.0E-65 |
| sp|B1XBQ7|UNG_ECODH | Uracil-DNA glycosylase OS=Escherichia coli (strain K12 / DH10B) GN=ung PE=3 SV=1 | 119 | 338 | 8.0E-65 |
| sp|C4ZYK3|UNG_ECOBW | Uracil-DNA glycosylase OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=ung PE=3 SV=1 | 119 | 338 | 8.0E-65 |
| sp|B7M8J5|UNG_ECO8A | Uracil-DNA glycosylase OS=Escherichia coli O8 (strain IAI1) GN=ung PE=3 SV=1 | 119 | 338 | 8.0E-65 |
| sp|B7LDH3|UNG_ECO55 | Uracil-DNA glycosylase OS=Escherichia coli (strain 55989 / EAEC) GN=ung PE=3 SV=1 | 119 | 338 | 8.0E-65 |
| sp|Q0T1S6|UNG_SHIF8 | Uracil-DNA glycosylase OS=Shigella flexneri serotype 5b (strain 8401) GN=ung PE=3 SV=1 | 119 | 338 | 1.0E-64 |
| sp|A0Q7Y8|UNG_FRATN | Uracil-DNA glycosylase OS=Francisella tularensis subsp. novicida (strain U112) GN=ung PE=3 SV=1 | 119 | 340 | 2.0E-64 |
| sp|Q32CT9|UNG_SHIDS | Uracil-DNA glycosylase OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=ung PE=3 SV=1 | 119 | 338 | 3.0E-64 |
| sp|B7N6H1|UNG_ECOLU | Uracil-DNA glycosylase OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=ung PE=3 SV=1 | 119 | 338 | 3.0E-64 |
| sp|B5Z154|UNG_ECO5E | Uracil-DNA glycosylase OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=ung PE=3 SV=1 | 119 | 338 | 3.0E-64 |
| sp|Q8X444|UNG_ECO57 | Uracil-DNA glycosylase OS=Escherichia coli O157:H7 GN=ung PE=3 SV=3 | 119 | 338 | 3.0E-64 |
| sp|Q8FF08|UNG_ECOL6 | Uracil-DNA glycosylase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=ung PE=3 SV=3 | 119 | 338 | 4.0E-64 |
| sp|A4WDE9|UNG_ENT38 | Uracil-DNA glycosylase OS=Enterobacter sp. (strain 638) GN=ung PE=3 SV=1 | 115 | 338 | 7.0E-64 |
| sp|B5F228|UNG_SALA4 | Uracil-DNA glycosylase OS=Salmonella agona (strain SL483) GN=ung PE=3 SV=1 | 119 | 338 | 2.0E-63 |
| sp|B4F058|UNG_PROMH | Uracil-DNA glycosylase OS=Proteus mirabilis (strain HI4320) GN=ung PE=3 SV=1 | 119 | 340 | 2.0E-63 |
| sp|P67073|UNG_SALTY | Uracil-DNA glycosylase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=ung PE=3 SV=2 | 119 | 338 | 3.0E-63 |
| sp|P67074|UNG_SALTI | Uracil-DNA glycosylase OS=Salmonella typhi GN=ung PE=3 SV=2 | 119 | 338 | 3.0E-63 |
| sp|B4TS29|UNG_SALSV | Uracil-DNA glycosylase OS=Salmonella schwarzengrund (strain CVM19633) GN=ung PE=3 SV=1 | 119 | 338 | 3.0E-63 |
| sp|B5BAR7|UNG_SALPK | Uracil-DNA glycosylase OS=Salmonella paratyphi A (strain AKU_12601) GN=ung PE=3 SV=1 | 119 | 338 | 3.0E-63 |
| sp|C0PVZ2|UNG_SALPC | Uracil-DNA glycosylase OS=Salmonella paratyphi C (strain RKS4594) GN=ung PE=3 SV=1 | 119 | 338 | 3.0E-63 |
| sp|A9N0W3|UNG_SALPB | Uracil-DNA glycosylase OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=ung PE=3 SV=1 | 119 | 338 | 3.0E-63 |
| sp|Q5PLH8|UNG_SALPA | Uracil-DNA glycosylase OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=ung PE=3 SV=1 | 119 | 338 | 3.0E-63 |
| sp|B4T290|UNG_SALNS | Uracil-DNA glycosylase OS=Salmonella newport (strain SL254) GN=ung PE=3 SV=1 | 119 | 338 | 3.0E-63 |
| sp|B4TE28|UNG_SALHS | Uracil-DNA glycosylase OS=Salmonella heidelberg (strain SL476) GN=ung PE=3 SV=1 | 119 | 338 | 3.0E-63 |
| sp|B5RD62|UNG_SALG2 | Uracil-DNA glycosylase OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=ung PE=3 SV=1 | 119 | 338 | 3.0E-63 |
| sp|B5QTW1|UNG_SALEP | Uracil-DNA glycosylase OS=Salmonella enteritidis PT4 (strain P125109) GN=ung PE=3 SV=1 | 119 | 338 | 3.0E-63 |
| sp|B5FRD9|UNG_SALDC | Uracil-DNA glycosylase OS=Salmonella dublin (strain CT_02021853) GN=ung PE=3 SV=1 | 119 | 338 | 3.0E-63 |
| sp|Q57L54|UNG_SALCH | Uracil-DNA glycosylase OS=Salmonella choleraesuis (strain SC-B67) GN=ung PE=3 SV=1 | 119 | 338 | 3.0E-63 |
| sp|Q7N1U8|UNG_PHOLL | Uracil-DNA glycosylase OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=ung PE=3 SV=1 | 119 | 326 | 3.0E-63 |
| sp|C4LC44|UNG_TOLAT | Uracil-DNA glycosylase OS=Tolumonas auensis (strain DSM 9187 / TA4) GN=ung PE=3 SV=1 | 118 | 340 | 4.0E-63 |
| sp|B5XNF8|UNG_KLEP3 | Uracil-DNA glycosylase OS=Klebsiella pneumoniae (strain 342) GN=ung PE=3 SV=1 | 115 | 338 | 5.0E-63 |
| sp|B6J738|UNG_COXB1 | Uracil-DNA glycosylase OS=Coxiella burnetii (strain CbuK_Q154) GN=ung PE=3 SV=1 | 118 | 340 | 6.0E-63 |
| sp|Q83CW4|UNG_COXBU | Uracil-DNA glycosylase OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=ung PE=1 SV=1 | 118 | 340 | 7.0E-63 |
| sp|P43731|UNG_HAEIN | Uracil-DNA glycosylase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=ung PE=3 SV=1 | 119 | 340 | 8.0E-63 |
| sp|Q92CI1|UNG2_LISIN | Uracil-DNA glycosylase 2 OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=ung2 PE=3 SV=1 | 116 | 342 | 8.0E-63 |
| sp|C3LQD1|UNG_VIBCM | Uracil-DNA glycosylase OS=Vibrio cholerae serotype O1 (strain M66-2) GN=ung PE=3 SV=1 | 119 | 326 | 4.0E-62 |
| sp|Q9KPK8|UNG_VIBCH | Uracil-DNA glycosylase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=ung PE=1 SV=1 | 119 | 326 | 4.0E-62 |
| sp|A5F5R5|UNG_VIBC3 | Uracil-DNA glycosylase OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=ung PE=3 SV=1 | 119 | 326 | 4.0E-62 |
| sp|B6EKY3|UNG_ALISL | Uracil-DNA glycosylase OS=Aliivibrio salmonicida (strain LFI1238) GN=ung PE=3 SV=1 | 116 | 339 | 8.0E-62 |
| sp|B6J089|UNG_COXB2 | Uracil-DNA glycosylase OS=Coxiella burnetii (strain CbuG_Q212) GN=ung PE=3 SV=1 | 118 | 340 | 8.0E-62 |
| sp|Q8Y7P6|UNG2_LISMO | Uracil-DNA glycosylase 2 OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=ung2 PE=3 SV=1 | 116 | 342 | 8.0E-62 |
| sp|Q1I5T6|UNG_PSEE4 | Uracil-DNA glycosylase OS=Pseudomonas entomophila (strain L48) GN=ung PE=3 SV=1 | 116 | 340 | 1.0E-61 |
| sp|A9KCD5|UNG_COXBN | Uracil-DNA glycosylase OS=Coxiella burnetii (strain Dugway 5J108-111) GN=ung PE=3 SV=2 | 118 | 340 | 1.0E-61 |
| sp|Q3KGL4|UNG_PSEPF | Uracil-DNA glycosylase OS=Pseudomonas fluorescens (strain Pf0-1) GN=ung PE=3 SV=1 | 116 | 340 | 2.0E-61 |
| sp|Q4QPM6|UNG_HAEI8 | Uracil-DNA glycosylase OS=Haemophilus influenzae (strain 86-028NP) GN=ung PE=3 SV=1 | 119 | 340 | 2.0E-61 |
| sp|Q02HQ1|UNG_PSEAB | Uracil-DNA glycosylase OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=ung PE=3 SV=1 | 116 | 340 | 3.0E-61 |
| sp|Q9I5H9|UNG_PSEAE | Uracil-DNA glycosylase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=ung PE=3 SV=1 | 116 | 340 | 5.0E-61 |
| sp|B7UYZ2|UNG_PSEA8 | Uracil-DNA glycosylase OS=Pseudomonas aeruginosa (strain LESB58) GN=ung PE=3 SV=1 | 116 | 340 | 5.0E-61 |
| sp|A6VAM7|UNG_PSEA7 | Uracil-DNA glycosylase OS=Pseudomonas aeruginosa (strain PA7) GN=ung PE=3 SV=1 | 116 | 340 | 5.0E-61 |
| sp|C1DQR0|UNG_AZOVD | Uracil-DNA glycosylase OS=Azotobacter vinelandii (strain DJ / ATCC BAA-1303) GN=ung PE=3 SV=1 | 116 | 340 | 5.0E-61 |
| sp|A9MGV9|UNG_SALAR | Uracil-DNA glycosylase OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=ung PE=3 SV=1 | 119 | 338 | 7.0E-61 |
| sp|Q2NS03|UNG_SODGM | Uracil-DNA glycosylase OS=Sodalis glossinidius (strain morsitans) GN=ung PE=3 SV=1 | 119 | 341 | 7.0E-61 |
| sp|A5UBC0|UNG_HAEIE | Uracil-DNA glycosylase OS=Haemophilus influenzae (strain PittEE) GN=ung PE=3 SV=1 | 145 | 340 | 9.0E-61 |
| sp|B0BTB4|UNG_ACTPJ | Uracil-DNA glycosylase OS=Actinobacillus pleuropneumoniae serotype 3 (strain JL03) GN=ung PE=3 SV=1 | 118 | 340 | 1.0E-60 |
| sp|B3H0M4|UNG_ACTP7 | Uracil-DNA glycosylase OS=Actinobacillus pleuropneumoniae serotype 7 (strain AP76) GN=ung PE=3 SV=1 | 118 | 340 | 1.0E-60 |
| sp|A3MZ80|UNG_ACTP2 | Uracil-DNA glycosylase OS=Actinobacillus pleuropneumoniae serotype 5b (strain L20) GN=ung PE=3 SV=1 | 118 | 340 | 1.0E-60 |
| sp|A5W8H2|UNG_PSEP1 | Uracil-DNA glycosylase OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=ung PE=3 SV=1 | 116 | 340 | 2.0E-60 |
| sp|B0UWA7|UNG_HISS2 | Uracil-DNA glycosylase OS=Histophilus somni (strain 2336) GN=ung PE=3 SV=1 | 118 | 340 | 2.0E-60 |
| sp|Q0I271|UNG_HAES1 | Uracil-DNA glycosylase OS=Haemophilus somnus (strain 129Pt) GN=ung PE=3 SV=1 | 118 | 340 | 2.0E-60 |
| sp|C3KDS6|UNG_PSEFS | Uracil-DNA glycosylase OS=Pseudomonas fluorescens (strain SBW25) GN=ung PE=3 SV=1 | 116 | 340 | 4.0E-60 |
| sp|Q7MNR0|UNG_VIBVY | Uracil-DNA glycosylase OS=Vibrio vulnificus (strain YJ016) GN=ung PE=3 SV=2 | 119 | 340 | 4.0E-60 |
| sp|Q8DEP7|UNG_VIBVU | Uracil-DNA glycosylase OS=Vibrio vulnificus (strain CMCP6) GN=ung PE=3 SV=1 | 119 | 340 | 4.0E-60 |
| sp|B0TXF5|UNG_FRAP2 | Uracil-DNA glycosylase OS=Francisella philomiragia subsp. philomiragia (strain ATCC 25017) GN=ung PE=3 SV=1 | 119 | 340 | 5.0E-60 |
| sp|A1JKI8|UNG_YERE8 | Uracil-DNA glycosylase OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=ung PE=3 SV=1 | 119 | 338 | 5.0E-60 |
| sp|B2VEC7|UNG_ERWT9 | Uracil-DNA glycosylase OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=ung PE=3 SV=1 | 119 | 338 | 5.0E-60 |
| sp|Q87XE2|UNG_PSESM | Uracil-DNA glycosylase OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=ung PE=3 SV=1 | 116 | 340 | 6.0E-60 |
| sp|Q88N05|UNG_PSEPK | Uracil-DNA glycosylase OS=Pseudomonas putida (strain KT2440) GN=ung PE=3 SV=1 | 116 | 340 | 6.0E-60 |
| sp|A6VLV4|UNG_ACTSZ | Uracil-DNA glycosylase OS=Actinobacillus succinogenes (strain ATCC 55618 / 130Z) GN=ung PE=3 SV=1 | 119 | 340 | 7.0E-60 |
| sp|A8GI39|UNG_SERP5 | Uracil-DNA glycosylase OS=Serratia proteamaculans (strain 568) GN=ung PE=3 SV=1 | 119 | 338 | 7.0E-60 |
| sp|Q4ZPC2|UNG_PSEU2 | Uracil-DNA glycosylase OS=Pseudomonas syringae pv. syringae (strain B728a) GN=ung PE=3 SV=1 | 116 | 340 | 1.0E-59 |
| sp|Q87SC4|UNG_VIBPA | Uracil-DNA glycosylase OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=ung PE=3 SV=1 | 119 | 340 | 2.0E-59 |
| sp|Q720K2|UNG2_LISMF | Uracil-DNA glycosylase 2 OS=Listeria monocytogenes serotype 4b (strain F2365) GN=ung2 PE=3 SV=1 | 116 | 342 | 2.0E-59 |
| sp|B0U620|UNG_XYLFM | Uracil-DNA glycosylase OS=Xylella fastidiosa (strain M12) GN=ung PE=3 SV=1 | 104 | 340 | 2.0E-59 |
| sp|Q9PA28|UNG_XYLFA | Uracil-DNA glycosylase OS=Xylella fastidiosa (strain 9a5c) GN=ung PE=3 SV=2 | 104 | 340 | 3.0E-59 |
| sp|A1KU26|UNG_NEIMF | Uracil-DNA glycosylase OS=Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18) GN=ung PE=3 SV=1 | 118 | 340 | 4.0E-59 |
| sp|Q9JZA1|UNG_NEIMB | Uracil-DNA glycosylase OS=Neisseria meningitidis serogroup B (strain MC58) GN=ung PE=3 SV=1 | 118 | 340 | 4.0E-59 |
| sp|A9LZA2|UNG_NEIM0 | Uracil-DNA glycosylase OS=Neisseria meningitidis serogroup C (strain 053442) GN=ung PE=3 SV=1 | 118 | 340 | 4.0E-59 |
| sp|Q879Z0|UNG_XYLFT | Uracil-DNA glycosylase OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=ung PE=3 SV=1 | 116 | 340 | 6.0E-59 |
| sp|B2IAB2|UNG_XYLF2 | Uracil-DNA glycosylase OS=Xylella fastidiosa (strain M23) GN=ung PE=3 SV=1 | 116 | 340 | 6.0E-59 |
| sp|C4Z8Z2|UNG_EUBR3 | Uracil-DNA glycosylase OS=Eubacterium rectale (strain ATCC 33656 / VPI 0990) GN=ung PE=3 SV=1 | 113 | 340 | 6.0E-59 |
| sp|P13051|UNG_HUMAN | Uracil-DNA glycosylase OS=Homo sapiens GN=UNG PE=1 SV=2 | 116 | 338 | 6.0E-59 |
| sp|Q48ET5|UNG_PSE14 | Uracil-DNA glycosylase OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=ung PE=3 SV=1 | 116 | 340 | 9.0E-59 |
| sp|Q92LU5|UNG_RHIME | Uracil-DNA glycosylase OS=Rhizobium meliloti (strain 1021) GN=ung PE=3 SV=1 | 116 | 340 | 1.0E-58 |
| sp|Q30Q92|UNG_SULDN | Uracil-DNA glycosylase OS=Sulfurimonas denitrificans (strain ATCC 33889 / DSM 1251) GN=ung PE=3 SV=1 | 108 | 329 | 1.0E-58 |
| sp|B4RLL6|UNG_NEIG2 | Uracil-DNA glycosylase OS=Neisseria gonorrhoeae (strain NCCP11945) GN=ung PE=3 SV=1 | 118 | 340 | 1.0E-58 |
| sp|Q5F8I7|UNG_NEIG1 | Uracil-DNA glycosylase OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=ung PE=3 SV=1 | 118 | 340 | 1.0E-58 |
| sp|Q4KGS0|UNG_PSEF5 | Uracil-DNA glycosylase OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=ung PE=3 SV=1 | 116 | 340 | 1.0E-58 |
| sp|Q9JUC4|UNG_NEIMA | Uracil-DNA glycosylase OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=ung PE=3 SV=1 | 118 | 340 | 3.0E-58 |
| sp|P97931|UNG_MOUSE | Uracil-DNA glycosylase OS=Mus musculus GN=Ung PE=1 SV=3 | 116 | 326 | 3.0E-58 |
| sp|B0KV50|UNG_PSEPG | Uracil-DNA glycosylase OS=Pseudomonas putida (strain GB-1) GN=ung PE=3 SV=1 | 116 | 340 | 4.0E-58 |
| sp|Q5E2Y8|UNG_VIBF1 | Uracil-DNA glycosylase OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=ung PE=3 SV=1 | 119 | 342 | 4.0E-58 |
| sp|B8F6C3|UNG_HAEPS | Uracil-DNA glycosylase OS=Haemophilus parasuis serovar 5 (strain SH0165) GN=ung PE=3 SV=1 | 118 | 340 | 5.0E-58 |
| sp|Q5KUD0|UNG_GEOKA | Uracil-DNA glycosylase OS=Geobacillus kaustophilus (strain HTA426) GN=ung PE=3 SV=1 | 115 | 342 | 5.0E-58 |
| sp|B1J4J3|UNG_PSEPW | Uracil-DNA glycosylase OS=Pseudomonas putida (strain W619) GN=ung PE=3 SV=1 | 116 | 340 | 7.0E-58 |
| sp|A6M317|UNG_CLOB8 | Uracil-DNA glycosylase OS=Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052) GN=ung PE=3 SV=1 | 114 | 340 | 9.0E-58 |
| sp|B5FAJ7|UNG_VIBFM | Uracil-DNA glycosylase OS=Vibrio fischeri (strain MJ11) GN=ung PE=3 SV=1 | 119 | 339 | 1.0E-57 |
| sp|Q65DN9|UNG_BACLD | Uracil-DNA glycosylase OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=ung PE=3 SV=1 | 114 | 340 | 1.0E-57 |
| sp|A7MS85|UNG_VIBCB | Uracil-DNA glycosylase OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=ung PE=3 SV=1 | 119 | 340 | 2.0E-57 |
| sp|Q7VMC0|UNG_HAEDU | Uracil-DNA glycosylase OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=ung PE=3 SV=1 | 118 | 340 | 2.0E-57 |
| sp|Q0TUH0|UNG_CLOP1 | Uracil-DNA glycosylase OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) GN=ung PE=3 SV=1 | 116 | 340 | 2.0E-57 |
| sp|P57807|UNG_PASMU | Uracil-DNA glycosylase OS=Pasteurella multocida (strain Pm70) GN=ung PE=3 SV=1 | 119 | 342 | 4.0E-57 |
| sp|Q667T7|UNG_YERPS | Uracil-DNA glycosylase OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=ung PE=3 SV=1 | 119 | 319 | 4.0E-57 |
| sp|A4TKZ2|UNG_YERPP | Uracil-DNA glycosylase OS=Yersinia pestis (strain Pestoides F) GN=ung PE=3 SV=1 | 119 | 319 | 4.0E-57 |
| sp|Q1CKF8|UNG_YERPN | Uracil-DNA glycosylase OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=ung PE=3 SV=1 | 119 | 319 | 4.0E-57 |
| sp|A9R3Y6|UNG_YERPG | Uracil-DNA glycosylase OS=Yersinia pestis bv. Antiqua (strain Angola) GN=ung PE=3 SV=1 | 119 | 319 | 4.0E-57 |
| sp|Q8ZD85|UNG_YERPE | Uracil-DNA glycosylase OS=Yersinia pestis GN=ung PE=3 SV=1 | 119 | 319 | 4.0E-57 |
| sp|Q1C570|UNG_YERPA | Uracil-DNA glycosylase OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=ung PE=3 SV=1 | 119 | 319 | 4.0E-57 |
| sp|A7FFS4|UNG_YERP3 | Uracil-DNA glycosylase OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=ung PE=3 SV=1 | 119 | 319 | 6.0E-57 |
| sp|Q8EPH6|UNG_OCEIH | Uracil-DNA glycosylase OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=ung PE=3 SV=1 | 116 | 340 | 7.0E-57 |
| sp|Q65VN0|UNG_MANSM | Uracil-DNA glycosylase OS=Mannheimia succiniciproducens (strain MBEL55E) GN=ung PE=3 SV=1 | 119 | 342 | 7.0E-57 |
| sp|Q8XNR7|UNG_CLOPE | Uracil-DNA glycosylase OS=Clostridium perfringens (strain 13 / Type A) GN=ung PE=3 SV=1 | 116 | 340 | 7.0E-57 |
| sp|Q0SWB8|UNG_CLOPS | Uracil-DNA glycosylase OS=Clostridium perfringens (strain SM101 / Type A) GN=ung PE=3 SV=1 | 116 | 340 | 1.0E-56 |
| sp|B1JRB1|UNG_YERPY | Uracil-DNA glycosylase OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=ung PE=3 SV=1 | 119 | 319 | 1.0E-56 |
| sp|B2KA63|UNG_YERPB | Uracil-DNA glycosylase OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=ung PE=3 SV=1 | 119 | 319 | 1.0E-56 |
| sp|Q8EB78|UNG_SHEON | Uracil-DNA glycosylase OS=Shewanella oneidensis (strain MR-1) GN=ung PE=3 SV=1 | 119 | 340 | 1.0E-56 |
| sp|Q3BNI2|UNG_XANC5 | Uracil-DNA glycosylase OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=ung PE=3 SV=1 | 116 | 340 | 1.0E-56 |
| sp|A6UDC0|UNG_SINMW | Uracil-DNA glycosylase OS=Sinorhizobium medicae (strain WSM419) GN=ung PE=3 SV=1 | 116 | 340 | 1.0E-56 |
| sp|Q6F9Y2|UNG_ACIAD | Uracil-DNA glycosylase OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=ung PE=3 SV=1 | 116 | 340 | 2.0E-56 |
| sp|Q8PFZ6|UNG_XANAC | Uracil-DNA glycosylase OS=Xanthomonas axonopodis pv. citri (strain 306) GN=ung PE=3 SV=1 | 116 | 340 | 3.0E-56 |
| sp|A9KP29|UNG_CLOPH | Uracil-DNA glycosylase OS=Clostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg) GN=ung PE=3 SV=1 | 113 | 342 | 5.0E-56 |
| sp|B0BA61|UNG_CHLTB | Uracil-DNA glycosylase OS=Chlamydia trachomatis serovar L2b (strain UCH-1/proctitis) GN=ung PE=3 SV=1 | 113 | 340 | 6.0E-56 |
| sp|B0B8I2|UNG_CHLT2 | Uracil-DNA glycosylase OS=Chlamydia trachomatis serovar L2 (strain 434/Bu / ATCC VR-902B) GN=ung PE=3 SV=1 | 113 | 340 | 6.0E-56 |
| sp|A0KMZ1|UNG_AERHH | Uracil-DNA glycosylase OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=ung PE=3 SV=1 | 118 | 338 | 7.0E-56 |
| sp|Q8P4D7|UNG_XANCP | Uracil-DNA glycosylase OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=ung PE=3 SV=1 | 116 | 342 | 8.0E-56 |
| sp|B0RWT2|UNG_XANCB | Uracil-DNA glycosylase OS=Xanthomonas campestris pv. campestris (strain B100) GN=ung PE=3 SV=1 | 116 | 342 | 8.0E-56 |
| sp|Q4UPY9|UNG_XANC8 | Uracil-DNA glycosylase OS=Xanthomonas campestris pv. campestris (strain 8004) GN=ung PE=3 SV=1 | 116 | 342 | 8.0E-56 |
| sp|A4ITQ2|UNG_GEOTN | Uracil-DNA glycosylase OS=Geobacillus thermodenitrificans (strain NG80-2) GN=ung PE=3 SV=1 | 115 | 342 | 9.0E-56 |
| sp|B7GMM1|UNG_ANOFW | Uracil-DNA glycosylase OS=Anoxybacillus flavithermus (strain DSM 21510 / WK1) GN=ung PE=3 SV=1 | 113 | 342 | 1.0E-55 |
| sp|Q9K3Z0|UNG2_STRCO | Uracil-DNA glycosylase 2 OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=ung2 PE=3 SV=1 | 112 | 340 | 2.0E-55 |
| sp|Q9PJD2|UNG_CHLMU | Uracil-DNA glycosylase OS=Chlamydia muridarum (strain MoPn / Nigg) GN=ung PE=3 SV=1 | 113 | 340 | 2.0E-55 |
| sp|Q5GUS2|UNG_XANOR | Uracil-DNA glycosylase OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=ung PE=3 SV=1 | 116 | 340 | 3.0E-55 |
| sp|B2SJF5|UNG_XANOP | Uracil-DNA glycosylase OS=Xanthomonas oryzae pv. oryzae (strain PXO99A) GN=ung PE=3 SV=1 | 116 | 340 | 3.0E-55 |
| sp|Q2NY21|UNG_XANOM | Uracil-DNA glycosylase OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=ung PE=3 SV=1 | 116 | 340 | 3.0E-55 |
| sp|Q827B3|UNG2_STRAW | Uracil-DNA glycosylase 2 OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=ung2 PE=3 SV=1 | 116 | 340 | 3.0E-55 |
| sp|Q24YA3|UNG_DESHY | Uracil-DNA glycosylase OS=Desulfitobacterium hafniense (strain Y51) GN=ung PE=3 SV=1 | 113 | 340 | 4.0E-55 |
| sp|B8FSV8|UNG_DESHD | Uracil-DNA glycosylase OS=Desulfitobacterium hafniense (strain DCB-2 / DSM 10664) GN=ung PE=3 SV=1 | 113 | 340 | 4.0E-55 |
| sp|P39615|UNG_BACSU | Uracil-DNA glycosylase OS=Bacillus subtilis (strain 168) GN=ung PE=1 SV=1 | 114 | 340 | 8.0E-55 |
| sp|O84613|UNG_CHLTR | Uracil-DNA glycosylase OS=Chlamydia trachomatis (strain D/UW-3/Cx) GN=ung PE=3 SV=1 | 113 | 340 | 9.0E-55 |
| sp|Q3KL88|UNG_CHLTA | Uracil-DNA glycosylase OS=Chlamydia trachomatis serovar A (strain ATCC VR-571B / DSM 19440 / HAR-13) GN=ung PE=3 SV=1 | 113 | 340 | 9.0E-55 |
| sp|A7GVE5|UNG_BACCN | Uracil-DNA glycosylase OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=ung PE=3 SV=1 | 114 | 340 | 1.0E-54 |
| sp|Q9RWH9|UNG_DEIRA | Uracil-DNA glycosylase OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=ung PE=1 SV=1 | 115 | 347 | 1.0E-54 |
| sp|Q8UCM8|UNG_AGRFC | Uracil-DNA glycosylase OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=ung PE=3 SV=1 | 116 | 340 | 2.0E-54 |
| sp|P29950|UNG_PSEDE | Uracil-DNA glycosylase (Fragment) OS=Pseudomonas denitrificans GN=ung PE=3 SV=1 | 127 | 340 | 2.0E-54 |
| sp|Q630K2|UNG_BACCZ | Uracil-DNA glycosylase OS=Bacillus cereus (strain ZK / E33L) GN=ung PE=3 SV=1 | 114 | 340 | 2.0E-54 |
| sp|Q81JQ4|UNG_BACAN | Uracil-DNA glycosylase OS=Bacillus anthracis GN=ung PE=3 SV=1 | 115 | 340 | 2.0E-54 |
| sp|C3LFS7|UNG_BACAC | Uracil-DNA glycosylase OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=ung PE=3 SV=1 | 115 | 340 | 2.0E-54 |
| sp|C3P2F8|UNG_BACAA | Uracil-DNA glycosylase OS=Bacillus anthracis (strain A0248) GN=ung PE=3 SV=1 | 115 | 340 | 2.0E-54 |
| sp|B9IS32|UNG_BACCQ | Uracil-DNA glycosylase OS=Bacillus cereus (strain Q1) GN=ung PE=3 SV=1 | 115 | 340 | 3.0E-54 |
| sp|B7HYF9|UNG_BACC7 | Uracil-DNA glycosylase OS=Bacillus cereus (strain AH187) GN=ung PE=3 SV=1 | 115 | 340 | 3.0E-54 |
| sp|Q814M9|UNG_BACCR | Uracil-DNA glycosylase OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=ung PE=3 SV=1 | 115 | 340 | 3.0E-54 |
| sp|B7HG60|UNG_BACC4 | Uracil-DNA glycosylase OS=Bacillus cereus (strain B4264) GN=ung PE=3 SV=1 | 115 | 340 | 3.0E-54 |
| sp|Q72X51|UNG_BACC1 | Uracil-DNA glycosylase OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=ung PE=3 SV=1 | 115 | 340 | 4.0E-54 |
| sp|Q8A5V6|UNG_BACTN | Uracil-DNA glycosylase OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) GN=ung PE=3 SV=1 | 109 | 338 | 5.0E-54 |
| sp|B7IRS8|UNG_BACC2 | Uracil-DNA glycosylase OS=Bacillus cereus (strain G9842) GN=ung PE=3 SV=1 | 115 | 340 | 6.0E-54 |
| sp|A7ZA24|UNG_BACMF | Uracil-DNA glycosylase OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=ung PE=3 SV=1 | 114 | 340 | 6.0E-54 |
| sp|Q64PM3|UNG2_BACFR | Uracil-DNA glycosylase 2 OS=Bacteroides fragilis (strain YCH46) GN=ung2 PE=3 SV=1 | 109 | 338 | 7.0E-54 |
| sp|Q5L9D9|UNG2_BACFN | Uracil-DNA glycosylase 2 OS=Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / JCM 11019 / NCTC 9343) GN=ung2 PE=3 SV=1 | 109 | 338 | 7.0E-54 |
| sp|C5D9T3|UNG_GEOSW | Uracil-DNA glycosylase OS=Geobacillus sp. (strain WCH70) GN=ung PE=3 SV=1 | 115 | 342 | 7.0E-54 |
| sp|A4SK71|UNG_AERS4 | Uracil-DNA glycosylase OS=Aeromonas salmonicida (strain A449) GN=ung PE=3 SV=1 | 119 | 343 | 8.0E-54 |
| sp|A9VSJ0|UNG_BACWK | Uracil-DNA glycosylase OS=Bacillus weihenstephanensis (strain KBAB4) GN=ung PE=3 SV=1 | 116 | 340 | 1.0E-53 |
| sp|Q6GJ88|UNG_STAAR | Uracil-DNA glycosylase OS=Staphylococcus aureus (strain MRSA252) GN=ung PE=1 SV=1 | 120 | 326 | 1.0E-53 |
| sp|Q2YS83|UNG_STAAB | Uracil-DNA glycosylase OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=ung PE=3 SV=1 | 120 | 326 | 1.0E-53 |
| sp|A8FIM7|UNG_BACP2 | Uracil-DNA glycosylase OS=Bacillus pumilus (strain SAFR-032) GN=ung PE=3 SV=1 | 116 | 340 | 1.0E-53 |
| sp|C1CXS7|UNG_DEIDV | Uracil-DNA glycosylase OS=Deinococcus deserti (strain VCD115 / DSM 17065 / LMG 22923) GN=ung PE=3 SV=1 | 116 | 340 | 1.0E-53 |
| sp|Q5WAZ9|UNG_BACSK | Uracil-DNA glycosylase OS=Bacillus clausii (strain KSM-K16) GN=ung PE=3 SV=1 | 115 | 340 | 1.0E-53 |
| sp|P67077|UNG_STAAW | Uracil-DNA glycosylase OS=Staphylococcus aureus (strain MW2) GN=ung PE=3 SV=1 | 120 | 326 | 2.0E-53 |
| sp|A8YZS8|UNG_STAAT | Uracil-DNA glycosylase OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=ung PE=3 SV=1 | 120 | 326 | 2.0E-53 |
| sp|P67076|UNG_STAAN | Uracil-DNA glycosylase OS=Staphylococcus aureus (strain N315) GN=ung PE=3 SV=1 | 120 | 326 | 2.0E-53 |
| sp|P67075|UNG_STAAM | Uracil-DNA glycosylase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=ung PE=3 SV=1 | 120 | 326 | 2.0E-53 |
| sp|A6QEN4|UNG_STAAE | Uracil-DNA glycosylase OS=Staphylococcus aureus (strain Newman) GN=ung PE=3 SV=1 | 120 | 326 | 2.0E-53 |
| sp|Q5HI95|UNG_STAAC | Uracil-DNA glycosylase OS=Staphylococcus aureus (strain COL) GN=ung PE=3 SV=1 | 120 | 326 | 2.0E-53 |
| sp|A5IQD5|UNG_STAA9 | Uracil-DNA glycosylase OS=Staphylococcus aureus (strain JH9) GN=ung PE=3 SV=1 | 120 | 326 | 2.0E-53 |
| sp|Q2G0J7|UNG_STAA8 | Uracil-DNA glycosylase OS=Staphylococcus aureus (strain NCTC 8325) GN=ung PE=3 SV=1 | 120 | 326 | 2.0E-53 |
| sp|Q2FJ62|UNG_STAA3 | Uracil-DNA glycosylase OS=Staphylococcus aureus (strain USA300) GN=ung PE=3 SV=1 | 120 | 326 | 2.0E-53 |
| sp|A6TZ58|UNG_STAA2 | Uracil-DNA glycosylase OS=Staphylococcus aureus (strain JH1) GN=ung PE=3 SV=1 | 120 | 326 | 2.0E-53 |
| sp|A7WZ22|UNG_STAA1 | Uracil-DNA glycosylase OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=ung PE=3 SV=1 | 120 | 326 | 2.0E-53 |
| sp|Q6GBQ6|UNG_STAAS | Uracil-DNA glycosylase OS=Staphylococcus aureus (strain MSSA476) GN=ung PE=3 SV=1 | 120 | 326 | 2.0E-53 |
| sp|Q6HAN7|UNG_BACHK | Uracil-DNA glycosylase OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=ung PE=3 SV=1 | 115 | 340 | 3.0E-53 |
| sp|C1EQ68|UNG_BACC3 | Uracil-DNA glycosylase OS=Bacillus cereus (strain 03BB102) GN=ung PE=3 SV=1 | 115 | 340 | 4.0E-53 |
| sp|A0RLI1|UNG_BACAH | Uracil-DNA glycosylase OS=Bacillus thuringiensis (strain Al Hakam) GN=ung PE=3 SV=1 | 115 | 340 | 4.0E-53 |
| sp|Q836Z5|UNG_ENTFA | Uracil-DNA glycosylase OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=ung PE=3 SV=1 | 114 | 340 | 8.0E-53 |
| sp|A6L7T5|UNG_BACV8 | Uracil-DNA glycosylase OS=Bacteroides vulgatus (strain ATCC 8482 / DSM 1447 / NCTC 11154) GN=ung PE=3 SV=1 | 109 | 326 | 8.0E-53 |
| sp|B1I012|UNG_LYSSC | Uracil-DNA glycosylase OS=Lysinibacillus sphaericus (strain C3-41) GN=ung PE=3 SV=1 | 114 | 340 | 8.0E-53 |
| sp|B2TQZ9|UNG_CLOBB | Uracil-DNA glycosylase OS=Clostridium botulinum (strain Eklund 17B / Type B) GN=ung PE=3 SV=1 | 114 | 342 | 8.0E-53 |
| sp|B2V017|UNG_CLOBA | Uracil-DNA glycosylase OS=Clostridium botulinum (strain Alaska E43 / Type E3) GN=ung PE=3 SV=1 | 114 | 342 | 8.0E-53 |
| sp|B9DKT3|UNG_STACT | Uracil-DNA glycosylase OS=Staphylococcus carnosus (strain TM300) GN=ung PE=3 SV=1 | 119 | 339 | 1.0E-52 |
| sp|A8MM35|UNG_ALKOO | Uracil-DNA glycosylase OS=Alkaliphilus oremlandii (strain OhILAs) GN=ung PE=3 SV=1 | 116 | 342 | 1.0E-52 |
| sp|B7JHM3|UNG_BACC0 | Uracil-DNA glycosylase OS=Bacillus cereus (strain AH820) GN=ung PE=3 SV=1 | 115 | 340 | 1.0E-52 |
| sp|Q7VRQ7|UNG_BLOFL | Uracil-DNA glycosylase OS=Blochmannia floridanus GN=ung PE=3 SV=1 | 119 | 340 | 2.0E-52 |
| sp|B0VMZ7|UNG_ACIBS | Uracil-DNA glycosylase OS=Acinetobacter baumannii (strain SDF) GN=ung PE=3 SV=1 | 116 | 340 | 2.0E-52 |
| sp|Q8R634|UNG_FUSNN | Uracil-DNA glycosylase OS=Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131) GN=ung PE=3 SV=1 | 116 | 342 | 3.0E-52 |
| sp|A3M500|UNG_ACIBT | Uracil-DNA glycosylase OS=Acinetobacter baumannii (strain ATCC 17978 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377) GN=ung PE=3 SV=2 | 116 | 340 | 3.0E-52 |
| sp|B2HZE0|UNG_ACIBC | Uracil-DNA glycosylase OS=Acinetobacter baumannii (strain ACICU) GN=ung PE=3 SV=1 | 116 | 340 | 3.0E-52 |
| sp|B0VD25|UNG_ACIBY | Uracil-DNA glycosylase OS=Acinetobacter baumannii (strain AYE) GN=ung PE=3 SV=1 | 116 | 340 | 4.0E-52 |
| sp|B7I526|UNG_ACIB5 | Uracil-DNA glycosylase OS=Acinetobacter baumannii (strain AB0057) GN=ung PE=3 SV=1 | 116 | 340 | 4.0E-52 |
| sp|B7H3L4|UNG_ACIB3 | Uracil-DNA glycosylase OS=Acinetobacter baumannii (strain AB307-0294) GN=ung PE=3 SV=1 | 116 | 340 | 4.0E-52 |
| sp|Q4L3Q7|UNG_STAHJ | Uracil-DNA glycosylase OS=Staphylococcus haemolyticus (strain JCSC1435) GN=ung PE=3 SV=1 | 120 | 329 | 9.0E-52 |
| sp|P69859|UNG_EHV1V | Uracil-DNA glycosylase OS=Equine herpesvirus 1 (strain V592) GN=61 PE=3 SV=1 | 119 | 340 | 1.0E-51 |
| sp|P28866|UNG_EHV1B | Uracil-DNA glycosylase OS=Equine herpesvirus 1 (strain Ab4p) GN=61 PE=3 SV=1 | 119 | 340 | 1.0E-51 |
| sp|Q49VD1|UNG_STAS1 | Uracil-DNA glycosylase OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=ung PE=3 SV=1 | 120 | 326 | 3.0E-51 |
| sp|Q03GV8|UNG_PEDPA | Uracil-DNA glycosylase OS=Pediococcus pentosaceus (strain ATCC 25745 / 183-1w) GN=ung PE=3 SV=1 | 114 | 348 | 4.0E-51 |
| sp|A0RM89|UNG_CAMFF | Uracil-DNA glycosylase OS=Campylobacter fetus subsp. fetus (strain 82-40) GN=ung PE=3 SV=1 | 116 | 344 | 6.0E-51 |
| sp|B2RHL6|UNG_PORG3 | Uracil-DNA glycosylase OS=Porphyromonas gingivalis (strain ATCC 33277 / DSM 20709 / JCM 12257) GN=ung PE=3 SV=1 | 116 | 326 | 7.0E-51 |
| sp|A7I0A8|UNG_CAMHC | Uracil-DNA glycosylase OS=Campylobacter hominis (strain ATCC BAA-381 / LMG 19568 / NCTC 13146 / CH001A) GN=ung PE=3 SV=1 | 109 | 341 | 7.0E-51 |
| sp|A1SUE5|UNG_PSYIN | Uracil-DNA glycosylase OS=Psychromonas ingrahamii (strain 37) GN=ung PE=3 SV=1 | 119 | 329 | 8.0E-51 |
| sp|Q1IWN1|UNG_DEIGD | Uracil-DNA glycosylase OS=Deinococcus geothermalis (strain DSM 11300) GN=ung PE=3 SV=1 | 116 | 340 | 1.0E-50 |
| sp|Q8CQ65|UNG_STAES | Uracil-DNA glycosylase OS=Staphylococcus epidermidis (strain ATCC 12228) GN=ung PE=3 SV=1 | 120 | 329 | 2.0E-50 |
| sp|Q5R080|UNG_IDILO | Uracil-DNA glycosylase OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=ung PE=3 SV=1 | 120 | 326 | 4.0E-50 |
| sp|Q9K682|UNG_BACHD | Uracil-DNA glycosylase OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=ung PE=3 SV=1 | 113 | 340 | 4.0E-50 |
| sp|A6TVW5|UNG_ALKMQ | Uracil-DNA glycosylase OS=Alkaliphilus metalliredigens (strain QYMF) GN=ung PE=3 SV=1 | 113 | 340 | 4.0E-50 |
| sp|A0M1V1|UNG_GRAFK | Uracil-DNA glycosylase OS=Gramella forsetii (strain KT0803) GN=ung PE=3 SV=1 | 116 | 338 | 5.0E-50 |
| sp|Q03KM6|UNG_STRTD | Uracil-DNA glycosylase OS=Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9) GN=ung PE=3 SV=1 | 119 | 338 | 5.0E-50 |
| sp|Q5HRG5|UNG_STAEQ | Uracil-DNA glycosylase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=ung PE=3 SV=1 | 120 | 329 | 5.0E-50 |
| sp|B8D787|UNG_BUCAT | Uracil-DNA glycosylase OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain Tuc7) GN=ung PE=3 SV=1 | 119 | 341 | 5.0E-50 |
| sp|P57280|UNG_BUCAI | Uracil-DNA glycosylase OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=ung PE=3 SV=1 | 119 | 341 | 5.0E-50 |
| sp|Q7MXF6|UNG_PORGI | Uracil-DNA glycosylase OS=Porphyromonas gingivalis (strain ATCC BAA-308 / W83) GN=ung PE=3 SV=1 | 116 | 326 | 1.0E-49 |
| sp|Q9LIH6|UNG_ARATH | Uracil-DNA glycosylase, mitochondrial OS=Arabidopsis thaliana GN=UNG PE=1 SV=1 | 116 | 340 | 2.0E-49 |
| sp|B2G626|UNG_LACRJ | Uracil-DNA glycosylase OS=Lactobacillus reuteri (strain JCM 1112) GN=ung PE=3 SV=1 | 114 | 340 | 2.0E-49 |
| sp|A5VIJ2|UNG_LACRD | Uracil-DNA glycosylase OS=Lactobacillus reuteri (strain DSM 20016) GN=ung PE=3 SV=1 | 114 | 340 | 2.0E-49 |
| sp|B9E8N2|UNG_MACCJ | Uracil-DNA glycosylase OS=Macrococcus caseolyticus (strain JCSC5402) GN=ung PE=3 SV=1 | 127 | 339 | 2.0E-49 |
| sp|Q3IG47|UNG_PSEHT | Uracil-DNA glycosylase OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=ung PE=3 SV=1 | 120 | 326 | 3.0E-49 |
| sp|A7ZAZ4|UNG_CAMC1 | Uracil-DNA glycosylase OS=Campylobacter concisus (strain 13826) GN=ung PE=3 SV=1 | 109 | 342 | 3.0E-49 |
| sp|Q07YI6|UNG_SHEFN | Uracil-DNA glycosylase OS=Shewanella frigidimarina (strain NCIMB 400) GN=ung PE=3 SV=1 | 116 | 340 | 3.0E-49 |
| sp|A7GVX1|UNG_CAMC5 | Uracil-DNA glycosylase OS=Campylobacter curvus (strain 525.92) GN=ung PE=3 SV=1 | 109 | 342 | 2.0E-48 |
| sp|B1YFL0|UNG_EXIS2 | Uracil-DNA glycosylase OS=Exiguobacterium sibiricum (strain DSM 17290 / JCM 13490 / 255-15) GN=ung PE=3 SV=1 | 116 | 341 | 2.0E-48 |
| sp|A5EVB8|UNG_DICNV | Uracil-DNA glycosylase OS=Dichelobacter nodosus (strain VCS1703A) GN=ung PE=3 SV=1 | 116 | 329 | 6.0E-48 |
| sp|Q64QI5|UNG1_BACFR | Uracil-DNA glycosylase 1 OS=Bacteroides fragilis (strain YCH46) GN=ung1 PE=3 SV=1 | 109 | 338 | 1.0E-47 |
| sp|Q5LA67|UNG1_BACFN | Uracil-DNA glycosylase 1 OS=Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / JCM 11019 / NCTC 9343) GN=ung1 PE=3 SV=1 | 109 | 338 | 2.0E-47 |
| sp|Q057V4|UNG_BUCCC | Uracil-DNA glycosylase OS=Buchnera aphidicola subsp. Cinara cedri (strain Cc) GN=ung PE=3 SV=1 | 119 | 340 | 3.0E-47 |
| sp|A7H1G3|UNG_CAMJD | Uracil-DNA glycosylase OS=Campylobacter jejuni subsp. doylei (strain ATCC BAA-1458 / RM4099 / 269.97) GN=ung PE=3 SV=1 | 109 | 341 | 3.0E-47 |
| sp|C0Z887|UNG_BREBN | Uracil-DNA glycosylase OS=Brevibacillus brevis (strain 47 / JCM 6285 / NBRC 100599) GN=ung PE=3 SV=1 | 116 | 340 | 4.0E-47 |
| sp|Q7P1I1|UNG_CHRVO | Uracil-DNA glycosylase OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=ung PE=3 SV=1 | 120 | 329 | 5.0E-47 |
| sp|A8FJP1|UNG_CAMJ8 | Uracil-DNA glycosylase OS=Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828) GN=ung PE=3 SV=1 | 109 | 341 | 9.0E-47 |
| sp|P59465|UNG_BUCBP | Uracil-DNA glycosylase OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=ung PE=3 SV=1 | 104 | 340 | 1.0E-46 |
| sp|Q5HX80|UNG_CAMJR | Uracil-DNA glycosylase OS=Campylobacter jejuni (strain RM1221) GN=ung PE=3 SV=1 | 109 | 341 | 1.0E-46 |
| sp|Q9PJ40|UNG_CAMJE | Uracil-DNA glycosylase OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=ung PE=3 SV=1 | 109 | 341 | 1.0E-46 |
| sp|P28275|UNG_HHV2H | Uracil-DNA glycosylase OS=Human herpesvirus 2 (strain HG52) GN=UL2 PE=3 SV=1 | 116 | 340 | 1.0E-46 |
| sp|Q315T1|UNG_DESAG | Uracil-DNA glycosylase OS=Desulfovibrio alaskensis (strain G20) GN=ung PE=3 SV=1 | 151 | 329 | 1.0E-46 |
| sp|P0A4P4|UNG_STRA5 | Uracil-DNA glycosylase OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=ung PE=3 SV=1 | 119 | 338 | 1.0E-46 |
| sp|P0A4P3|UNG_STRA3 | Uracil-DNA glycosylase OS=Streptococcus agalactiae serotype III (strain NEM316) GN=ung PE=3 SV=1 | 119 | 338 | 1.0E-46 |
| sp|P0A4P5|UNG_STRA1 | Uracil-DNA glycosylase OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) GN=ung PE=3 SV=1 | 119 | 338 | 1.0E-46 |
| sp|Q256I7|UNG_CHLFF | Uracil-DNA glycosylase OS=Chlamydophila felis (strain Fe/C-56) GN=ung PE=3 SV=1 | 111 | 326 | 1.0E-46 |
| sp|A1VXG9|UNG_CAMJJ | Uracil-DNA glycosylase OS=Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176) GN=ung PE=3 SV=1 | 109 | 341 | 1.0E-46 |
| sp|B2GAM7|UNG_LACF3 | Uracil-DNA glycosylase OS=Lactobacillus fermentum (strain NBRC 3956 / LMG 18251) GN=ung PE=3 SV=1 | 114 | 342 | 1.0E-46 |
| sp|B6YR15|UNG_AZOPC | Uracil-DNA glycosylase OS=Azobacteroides pseudotrichonymphae genomovar. CFP2 GN=ung PE=3 SV=1 | 109 | 326 | 2.0E-46 |
| sp|A5FFT1|UNG_FLAJ1 | Uracil-DNA glycosylase OS=Flavobacterium johnsoniae (strain ATCC 17061 / DSM 2064 / UW101) GN=ung PE=3 SV=1 | 116 | 338 | 2.0E-46 |
| sp|B3ERG6|UNG_AMOA5 | Uracil-DNA glycosylase OS=Amoebophilus asiaticus (strain 5a2) GN=ung PE=3 SV=1 | 119 | 327 | 2.0E-46 |
| sp|A8YUE7|UNG_LACH4 | Uracil-DNA glycosylase OS=Lactobacillus helveticus (strain DPC 4571) GN=ung PE=3 SV=1 | 114 | 341 | 3.0E-46 |
| sp|P10186|UNG_HHV11 | Uracil-DNA glycosylase OS=Human herpesvirus 1 (strain 17) GN=UL2 PE=1 SV=1 | 116 | 340 | 3.0E-46 |
| sp|A3CN85|UNG_STRSV | Uracil-DNA glycosylase OS=Streptococcus sanguinis (strain SK36) GN=ung PE=3 SV=1 | 119 | 329 | 3.0E-46 |
| sp|A4VV30|UNG_STRSY | Uracil-DNA glycosylase OS=Streptococcus suis (strain 05ZYH33) GN=ung PE=3 SV=1 | 119 | 338 | 3.0E-46 |
| sp|A4W1D5|UNG_STRS2 | Uracil-DNA glycosylase OS=Streptococcus suis (strain 98HAH33) GN=ung PE=3 SV=1 | 119 | 338 | 3.0E-46 |
| sp|Q5FL46|UNG_LACAC | Uracil-DNA glycosylase OS=Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM) GN=ung PE=3 SV=1 | 114 | 340 | 4.0E-46 |
| sp|Q5L4Q4|UNG_CHLAB | Uracil-DNA glycosylase OS=Chlamydophila abortus (strain DSM 27085 / S26/3) GN=ung PE=3 SV=1 | 111 | 326 | 5.0E-46 |
| sp|Q8DTV8|UNG_STRMU | Uracil-DNA glycosylase OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=ung PE=3 SV=1 | 119 | 338 | 6.0E-46 |
| sp|B1IBW9|UNG_STRPI | Uracil-DNA glycosylase OS=Streptococcus pneumoniae (strain Hungary19A-6) GN=ung PE=3 SV=1 | 119 | 338 | 6.0E-46 |
| sp|A8AXM4|UNG_STRGC | Uracil-DNA glycosylase OS=Streptococcus gordonii (strain Challis / ATCC 35105 / CH1 / DL1 / V288) GN=ung PE=3 SV=1 | 119 | 329 | 6.0E-46 |
| sp|B9KEK7|UNG_CAMLR | Uracil-DNA glycosylase OS=Campylobacter lari (strain RM2100 / D67 / ATCC BAA-1060) GN=ung PE=3 SV=1 | 111 | 341 | 8.0E-46 |
| sp|Q38VY5|UNG_LACSS | Uracil-DNA glycosylase OS=Lactobacillus sakei subsp. sakei (strain 23K) GN=ung PE=3 SV=1 | 116 | 348 | 1.0E-45 |
| sp|Q821F7|UNG_CHLCV | Uracil-DNA glycosylase OS=Chlamydophila caviae (strain GPIC) GN=ung PE=3 SV=1 | 111 | 326 | 1.0E-45 |
| sp|Q03SK6|UNG_LACBA | Uracil-DNA glycosylase OS=Lactobacillus brevis (strain ATCC 367 / JCM 1170) GN=ung PE=3 SV=1 | 116 | 345 | 1.0E-45 |
| sp|B2UDL1|UNG_RALPJ | Uracil-DNA glycosylase OS=Ralstonia pickettii (strain 12J) GN=ung PE=3 SV=1 | 109 | 338 | 2.0E-45 |
| sp|P53766|UNG_DICDI | Uracil-DNA glycosylase OS=Dictyostelium discoideum GN=uglA PE=2 SV=2 | 110 | 341 | 2.0E-45 |
| sp|B3WCZ5|UNG_LACCB | Uracil-DNA glycosylase OS=Lactobacillus casei (strain BL23) GN=ung PE=3 SV=1 | 116 | 340 | 2.0E-45 |
| sp|Q03AI1|UNG_LACC3 | Uracil-DNA glycosylase OS=Lactobacillus casei (strain ATCC 334) GN=ung PE=3 SV=1 | 116 | 340 | 2.0E-45 |
| sp|Q9Z7D3|UNG_CHLPN | Uracil-DNA glycosylase OS=Chlamydia pneumoniae GN=ung PE=3 SV=1 | 114 | 340 | 2.0E-45 |
| sp|P52506|UNG_SUHVF | Uracil-DNA glycosylase OS=Suid herpesvirus 1 (strain Indiana-Funkhauser / Becker) GN=UL2 PE=3 SV=1 | 119 | 340 | 3.0E-45 |
| sp|P52507|UNG_SUHVK | Uracil-DNA glycosylase OS=Suid herpesvirus 1 (strain Kaplan) GN=UL2 PE=3 SV=1 | 119 | 340 | 3.0E-45 |
| sp|Q9J3N2|UNG_VZVO | Uracil-DNA glycosylase OS=Varicella-zoster virus (strain Oka vaccine) GN=ORF59 PE=3 SV=1 | 120 | 340 | 4.0E-45 |
| sp|P09307|UNG_VZVD | Uracil-DNA glycosylase OS=Varicella-zoster virus (strain Dumas) GN=ORF59 PE=3 SV=1 | 120 | 340 | 4.0E-45 |
| sp|Q1GB22|UNG_LACDA | Uracil-DNA glycosylase OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC 11842 / DSM 20081 / JCM 1002 / NBRC 13953 / NCIMB 11778) GN=ung PE=3 SV=1 | 116 | 340 | 5.0E-45 |
| sp|Q04BG7|UNG_LACDB | Uracil-DNA glycosylase OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC BAA-365) GN=ung PE=3 SV=1 | 116 | 344 | 7.0E-45 |
| sp|B7J0Y9|UNG_BORBZ | Uracil-DNA glycosylase OS=Borrelia burgdorferi (strain ZS7) GN=ung PE=3 SV=1 | 116 | 326 | 8.0E-45 |
| sp|O51082|UNG_BORBU | Uracil-DNA glycosylase OS=Borrelia burgdorferi (strain ATCC 35210 / B31 / CIP 102532 / DSM 4680) GN=ung PE=3 SV=1 | 116 | 326 | 8.0E-45 |
| sp|P13158|UNG_HHV23 | Uracil-DNA glycosylase OS=Human herpesvirus 2 (strain 333) GN=UL2 PE=2 SV=1 | 116 | 329 | 1.0E-44 |
| sp|P12888|UNG_EBVB9 | Uracil-DNA glycosylase OS=Epstein-Barr virus (strain B95-8) GN=UNG PE=1 SV=1 | 151 | 340 | 1.0E-44 |
| sp|C1CRP5|UNG_STRZT | Uracil-DNA glycosylase OS=Streptococcus pneumoniae (strain Taiwan19F-14) GN=ung PE=3 SV=1 | 119 | 338 | 1.0E-44 |
| sp|C1CED4|UNG_STRZJ | Uracil-DNA glycosylase OS=Streptococcus pneumoniae (strain JJA) GN=ung PE=3 SV=1 | 119 | 338 | 1.0E-44 |
| sp|P23379|UNG_STRPN | Uracil-DNA glycosylase OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=ung PE=3 SV=2 | 119 | 338 | 1.0E-44 |
| sp|B8ZQ48|UNG_STRPJ | Uracil-DNA glycosylase OS=Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1) GN=ung PE=3 SV=1 | 119 | 338 | 1.0E-44 |
| sp|C1CKR8|UNG_STRZP | Uracil-DNA glycosylase OS=Streptococcus pneumoniae (strain P1031) GN=ung PE=3 SV=1 | 119 | 338 | 1.0E-44 |
| sp|Q8DPQ4|UNG_STRR6 | Uracil-DNA glycosylase OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=ung PE=3 SV=2 | 119 | 338 | 1.0E-44 |
| sp|B5E4R3|UNG_STRP4 | Uracil-DNA glycosylase OS=Streptococcus pneumoniae serotype 19F (strain G54) GN=ung PE=3 SV=1 | 119 | 338 | 1.0E-44 |
| sp|Q04KE2|UNG_STRP2 | Uracil-DNA glycosylase OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=ung PE=3 SV=1 | 119 | 338 | 1.0E-44 |
| sp|Q7MA00|UNG_WOLSU | Uracil-DNA glycosylase OS=Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / LMG 7466 / NCTC 11488 / FDC 602W) GN=ung PE=3 SV=1 | 108 | 340 | 1.0E-44 |
| sp|Q0SPB2|UNG_BORAP | Uracil-DNA glycosylase OS=Borrelia afzelii (strain PKo) GN=ung PE=3 SV=1 | 113 | 326 | 2.0E-44 |
| sp|Q74K70|UNG_LACJO | Uracil-DNA glycosylase OS=Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533) GN=ung PE=3 SV=1 | 116 | 340 | 2.0E-44 |
| sp|Q8XVE4|UNG_RALSO | Uracil-DNA glycosylase OS=Ralstonia solanacearum (strain GMI1000) GN=ung PE=3 SV=1 | 112 | 338 | 2.0E-44 |
| sp|A8EWN8|UNG_ARCB4 | Uracil-DNA glycosylase OS=Arcobacter butzleri (strain RM4018) GN=ung PE=3 SV=1 | 119 | 326 | 2.0E-44 |
| sp|Q92EQ0|UNG1_LISIN | Uracil-DNA glycosylase 1 OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=ung1 PE=3 SV=1 | 119 | 342 | 4.0E-44 |
| sp|Q662W1|UNG_BORBP | Uracil-DNA glycosylase OS=Borrelia bavariensis (strain ATCC BAA-2496 / DSM 23469 / PBi) GN=ung PE=3 SV=1 | 116 | 326 | 4.0E-44 |
| sp|Q9E6R2|UNG_GAHVM | Uracil-DNA glycosylase OS=Gallid herpesvirus 2 (strain Chicken/Md5/ATCC VR-987) GN=MDV014 PE=3 SV=1 | 115 | 342 | 4.0E-44 |
| sp|B2S1N8|UNG_BORHD | Uracil-DNA glycosylase OS=Borrelia hermsii (strain HS1 / DAH) GN=ung PE=3 SV=1 | 116 | 326 | 5.0E-44 |
| sp|P53764|UNG_BHV1C | Uracil-DNA glycosylase OS=Bovine herpesvirus 1.1 (strain Cooper) GN=UL2 PE=3 SV=1 | 151 | 341 | 1.0E-43 |
| sp|B5RKV2|UNG_BORDL | Uracil-DNA glycosylase OS=Borrelia duttonii (strain Ly) GN=ung PE=3 SV=1 | 116 | 326 | 2.0E-43 |
| sp|Q88YG1|UNG_LACPL | Uracil-DNA glycosylase OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=ung PE=3 SV=1 | 116 | 340 | 2.0E-43 |
| sp|Q723S4|UNG1_LISMF | Uracil-DNA glycosylase 1 OS=Listeria monocytogenes serotype 4b (strain F2365) GN=ung1 PE=3 SV=1 | 119 | 342 | 8.0E-43 |
| sp|B9DSB9|UNG_STRU0 | Uracil-DNA glycosylase OS=Streptococcus uberis (strain ATCC BAA-854 / 0140J) GN=ung PE=3 SV=1 | 119 | 338 | 1.0E-42 |
| sp|Q8Y9X7|UNG1_LISMO | Uracil-DNA glycosylase 1 OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=ung1 PE=3 SV=1 | 119 | 341 | 1.0E-42 |
| sp|B5RQN2|UNG_BORRA | Uracil-DNA glycosylase OS=Borrelia recurrentis (strain A1) GN=ung PE=3 SV=1 | 116 | 326 | 1.0E-42 |
| sp|Q98PV4|UNG_MYCPU | Uracil-DNA glycosylase OS=Mycoplasma pulmonis (strain UAB CTIP) GN=ung PE=3 SV=1 | 117 | 340 | 1.0E-42 |
| sp|A1QYK3|UNG_BORT9 | Uracil-DNA glycosylase OS=Borrelia turicatae (strain 91E135) GN=ung PE=3 SV=1 | 116 | 326 | 2.0E-42 |
| sp|B1MXY4|UNG_LEUCK | Uracil-DNA glycosylase OS=Leuconostoc citreum (strain KM20) GN=ung PE=3 SV=1 | 119 | 338 | 3.0E-42 |
| sp|O36395|UNG_ALHV1 | Uracil-DNA glycosylase OS=Alcelaphine herpesvirus 1 (strain C500) GN=46 PE=3 SV=1 | 151 | 340 | 6.0E-42 |
| sp|P53765|UNG_EHV2 | Uracil-DNA glycosylase OS=Equine herpesvirus 2 (strain 86/87) GN=46 PE=3 SV=2 | 132 | 340 | 2.0E-40 |
| sp|Q03W63|UNG_LEUMM | Uracil-DNA glycosylase OS=Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / NCDO 523) GN=ung PE=3 SV=1 | 119 | 338 | 7.0E-40 |
| sp|B4U3D4|UNG_STREM | Uracil-DNA glycosylase OS=Streptococcus equi subsp. zooepidemicus (strain MGCS10565) GN=ung PE=3 SV=1 | 119 | 338 | 3.0E-39 |
| sp|C0M7J9|UNG_STRE4 | Uracil-DNA glycosylase OS=Streptococcus equi subsp. equi (strain 4047) GN=ung PE=3 SV=1 | 119 | 338 | 3.0E-39 |
| sp|Q01019|UNG_SHV21 | Uracil-DNA glycosylase OS=Saimiriine herpesvirus 2 (strain 11) GN=46 PE=3 SV=1 | 151 | 326 | 5.0E-39 |
| sp|C0ME57|UNG_STRS7 | Uracil-DNA glycosylase OS=Streptococcus equi subsp. zooepidemicus (strain H70) GN=ung PE=3 SV=1 | 119 | 338 | 6.0E-39 |
| sp|B5XL20|UNG_STRPZ | Uracil-DNA glycosylase OS=Streptococcus pyogenes serotype M49 (strain NZ131) GN=ung PE=3 SV=1 | 120 | 338 | 8.0E-39 |
| sp|Q48U05|UNG_STRPM | Uracil-DNA glycosylase OS=Streptococcus pyogenes serotype M28 (strain MGAS6180) GN=ung PE=3 SV=1 | 120 | 338 | 8.0E-39 |
| sp|Q1JHA5|UNG_STRPD | Uracil-DNA glycosylase OS=Streptococcus pyogenes serotype M2 (strain MGAS10270) GN=ung PE=3 SV=1 | 120 | 338 | 1.0E-38 |
| sp|Q1JM60|UNG_STRPC | Uracil-DNA glycosylase OS=Streptococcus pyogenes serotype M12 (strain MGAS9429) GN=ung PE=3 SV=1 | 120 | 338 | 1.0E-38 |
| sp|Q1JC76|UNG_STRPB | Uracil-DNA glycosylase OS=Streptococcus pyogenes serotype M12 (strain MGAS2096) GN=ung PE=3 SV=1 | 120 | 338 | 1.0E-38 |
| sp|Q9A072|UNG_STRP1 | Uracil-DNA glycosylase OS=Streptococcus pyogenes serotype M1 GN=ung PE=3 SV=1 | 120 | 338 | 1.0E-38 |
| sp|A2RF00|UNG_STRPG | Uracil-DNA glycosylase OS=Streptococcus pyogenes serotype M5 (strain Manfredo) GN=ung PE=3 SV=1 | 120 | 338 | 5.0E-38 |
| sp|Q4A8N4|UNG_MYCH7 | Uracil-DNA glycosylase OS=Mycoplasma hyopneumoniae (strain 7448) GN=ung PE=3 SV=1 | 119 | 340 | 8.0E-38 |
| sp|Q1J724|UNG_STRPF | Uracil-DNA glycosylase OS=Streptococcus pyogenes serotype M4 (strain MGAS10750) GN=ung PE=3 SV=1 | 120 | 338 | 1.0E-37 |
| sp|P0DG75|UNG_STRPQ | Uracil-DNA glycosylase OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=ung PE=3 SV=1 | 120 | 338 | 2.0E-37 |
| sp|P0DG74|UNG_STRP3 | Uracil-DNA glycosylase OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=ung PE=3 SV=1 | 120 | 338 | 2.0E-37 |
| sp|Q5XCK3|UNG_STRP6 | Uracil-DNA glycosylase OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=ung PE=3 SV=1 | 120 | 338 | 2.0E-37 |
| sp|Q8P1B6|UNG_STRP8 | Uracil-DNA glycosylase OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=ung PE=3 SV=1 | 120 | 338 | 2.0E-37 |
| sp|Q1GHJ4|UNG_RUEST | Uracil-DNA glycosylase OS=Ruegeria sp. (strain TM1040) GN=ung PE=3 SV=1 | 148 | 339 | 7.0E-37 |
| sp|F5HI85|UNG_HCMVM | Uracil-DNA glycosylase OS=Human cytomegalovirus (strain Merlin) GN=UL114 PE=3 SV=1 | 93 | 341 | 8.0E-37 |
| sp|P16769|UL114_HCMVA | Uracil-DNA glycosylase OS=Human cytomegalovirus (strain AD169) GN=UL114 PE=3 SV=1 | 93 | 341 | 8.0E-37 |
| sp|F5HFA1|UNG_HHV8P | Uracil-DNA glycosylase OS=Human herpesvirus 8 type P (isolate GK18) GN=ORF46 PE=3 SV=1 | 120 | 340 | 1.0E-36 |
| sp|Q2L0Y2|UNG_BORA1 | Uracil-DNA glycosylase OS=Bordetella avium (strain 197N) GN=ung PE=3 SV=1 | 169 | 351 | 1.0E-36 |
| sp|Q9CBS3|UNG_MYCLE | Uracil-DNA glycosylase OS=Mycobacterium leprae (strain TN) GN=ung PE=3 SV=1 | 114 | 340 | 2.0E-36 |
| sp|B8ZS02|UNG_MYCLB | Uracil-DNA glycosylase OS=Mycobacterium leprae (strain Br4923) GN=ung PE=3 SV=1 | 114 | 340 | 2.0E-36 |
| sp|Q7VGS1|UNG_HELHP | Uracil-DNA glycosylase OS=Helicobacter hepaticus (strain ATCC 51449 / 3B1) GN=ung PE=3 SV=1 | 109 | 326 | 6.0E-36 |
| sp|Q21SE9|UNG_RHOFT | Uracil-DNA glycosylase OS=Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118) GN=ung PE=3 SV=1 | 120 | 327 | 6.0E-36 |
| sp|A9IGW1|UNG_BORPD | Uracil-DNA glycosylase OS=Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448) GN=ung PE=3 SV=1 | 116 | 338 | 2.0E-35 |
| sp|Q5YRZ2|UNG_NOCFA | Uracil-DNA glycosylase OS=Nocardia farcinica (strain IFM 10152) GN=ung PE=3 SV=1 | 114 | 340 | 2.0E-35 |
| sp|A0QJA9|UNG_MYCA1 | Uracil-DNA glycosylase OS=Mycobacterium avium (strain 104) GN=ung PE=3 SV=1 | 114 | 340 | 4.0E-35 |
| sp|Q73VJ7|UNG_MYCPA | Uracil-DNA glycosylase OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=ung PE=3 SV=1 | 114 | 340 | 5.0E-35 |
| sp|Q9PPU2|UNG_UREPA | Uracil-DNA glycosylase OS=Ureaplasma parvum serovar 3 (strain ATCC 700970) GN=ung PE=3 SV=1 | 151 | 327 | 7.0E-35 |
| sp|B1AJI8|UNG_UREP2 | Uracil-DNA glycosylase OS=Ureaplasma parvum serovar 3 (strain ATCC 27815 / 27 / NCTC 11736) GN=ung PE=3 SV=1 | 151 | 327 | 7.0E-35 |
| sp|Q1BAP2|UNG_MYCSS | Uracil-DNA glycosylase OS=Mycobacterium sp. (strain MCS) GN=ung PE=3 SV=1 | 114 | 340 | 1.0E-34 |
| sp|A1UEC0|UNG_MYCSK | Uracil-DNA glycosylase OS=Mycobacterium sp. (strain KMS) GN=ung PE=3 SV=1 | 114 | 340 | 1.0E-34 |
| sp|A3PXS4|UNG_MYCSJ | Uracil-DNA glycosylase OS=Mycobacterium sp. (strain JLS) GN=ung PE=3 SV=1 | 114 | 340 | 1.0E-34 |
| sp|A1SNW4|UNG_NOCSJ | Uracil-DNA glycosylase OS=Nocardioides sp. (strain BAA-499 / JS614) GN=ung PE=3 SV=1 | 129 | 340 | 2.0E-34 |
| sp|A0PQ07|UNG_MYCUA | Uracil-DNA glycosylase OS=Mycobacterium ulcerans (strain Agy99) GN=ung PE=3 SV=1 | 114 | 340 | 2.0E-34 |
| sp|B2HIJ2|UNG_MYCMM | Uracil-DNA glycosylase OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=ung PE=3 SV=1 | 114 | 340 | 3.0E-34 |
| sp|Q9CIX2|UNG_LACLA | Uracil-DNA glycosylase OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=ung PE=3 SV=1 | 120 | 339 | 3.0E-34 |
| sp|Q8G3E9|UNG_BIFLO | Uracil-DNA glycosylase OS=Bifidobacterium longum (strain NCC 2705) GN=ung PE=3 SV=1 | 139 | 340 | 4.0E-34 |
| sp|P50639|UNG_HHV7J | Uracil-DNA glycosylase OS=Human herpesvirus 7 (strain JI) GN=U81 PE=3 SV=1 | 151 | 342 | 5.0E-34 |
| sp|B5ZC55|UNG_UREU1 | Uracil-DNA glycosylase OS=Ureaplasma urealyticum serovar 10 (strain ATCC 33699 / Western) GN=ung PE=3 SV=1 | 151 | 330 | 8.0E-34 |
| sp|Q032L5|UNG_LACLS | Uracil-DNA glycosylase OS=Lactococcus lactis subsp. cremoris (strain SK11) GN=ung PE=3 SV=1 | 120 | 339 | 8.0E-34 |
| sp|A2RHW2|UNG_LACLM | Uracil-DNA glycosylase OS=Lactococcus lactis subsp. cremoris (strain MG1363) GN=ung PE=3 SV=1 | 120 | 339 | 9.0E-34 |
| sp|A0QV01|UNG_MYCS2 | Uracil-DNA glycosylase OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=ung PE=3 SV=1 | 114 | 340 | 2.0E-33 |
| sp|Q7W1Y7|UNG_BORPA | Uracil-DNA glycosylase OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=ung PE=3 SV=1 | 120 | 348 | 1.0E-32 |
| sp|Q7WQW5|UNG_BORBR | Uracil-DNA glycosylase OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=ung PE=3 SV=1 | 120 | 348 | 1.0E-32 |
| sp|Q7VUM8|UNG_BORPE | Uracil-DNA glycosylase OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=ung PE=3 SV=1 | 120 | 348 | 3.0E-32 |
| sp|A4TE31|UNG_MYCGI | Uracil-DNA glycosylase OS=Mycobacterium gilvum (strain PYR-GCK) GN=ung PE=3 SV=1 | 114 | 340 | 3.0E-32 |
| sp|P9WFQ9|UNG_MYCTU | Uracil-DNA glycosylase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ung PE=1 SV=1 | 114 | 340 | 4.0E-32 |
| sp|P9WFQ8|UNG_MYCTO | Uracil-DNA glycosylase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ung PE=3 SV=1 | 114 | 340 | 4.0E-32 |
| sp|A5U6Y7|UNG_MYCTA | Uracil-DNA glycosylase OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=ung PE=3 SV=1 | 114 | 340 | 4.0E-32 |
| sp|C1AG91|UNG_MYCBT | Uracil-DNA glycosylase OS=Mycobacterium bovis (strain BCG / Tokyo 172 / ATCC 35737 / TMC 1019) GN=ung PE=3 SV=1 | 114 | 340 | 4.0E-32 |
| sp|A1KMX0|UNG_MYCBP | Uracil-DNA glycosylase OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=ung PE=3 SV=1 | 114 | 340 | 4.0E-32 |
| sp|P67072|UNG_MYCBO | Uracil-DNA glycosylase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ung PE=3 SV=1 | 114 | 340 | 4.0E-32 |
| sp|A1T717|UNG_MYCVP | Uracil-DNA glycosylase OS=Mycobacterium vanbaalenii (strain DSM 7251 / PYR-1) GN=ung PE=3 SV=1 | 114 | 340 | 5.0E-32 |
| sp|P52345|UNG_HHV6U | Uracil-DNA glycosylase OS=Human herpesvirus 6A (strain Uganda-1102) GN=U81 PE=3 SV=1 | 119 | 342 | 6.0E-32 |
| sp|Q8FPQ4|UNG_COREF | Uracil-DNA glycosylase OS=Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395) GN=ung PE=3 SV=1 | 119 | 340 | 1.0E-31 |
| sp|P52447|UNG_HHV6Z | Uracil-DNA glycosylase OS=Human herpesvirus 6B (strain Z29) GN=U81 PE=3 SV=1 | 152 | 342 | 2.0E-31 |
| sp|Q6UDG6|UNG_PSHV1 | Uracil-DNA glycosylase OS=Psittacid herpesvirus 1 (isolate Amazon parrot/-/97-0001/1997) GN=UL2 PE=3 SV=1 | 116 | 326 | 2.0E-31 |
| sp|Q9EX12|UNG1_STRCO | Uracil-DNA glycosylase 1 OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=ung1 PE=3 SV=1 | 114 | 340 | 2.0E-31 |
| sp|Q47Q90|UNG_THEFY | Uracil-DNA glycosylase OS=Thermobifida fusca (strain YX) GN=ung PE=3 SV=1 | 114 | 340 | 3.0E-31 |
| sp|B1MDP0|UNG_MYCA9 | Uracil-DNA glycosylase OS=Mycobacterium abscessus (strain ATCC 19977 / DSM 44196 / CIP 104536 / JCM 13569 / NCTC 13031 / TMC 1543) GN=ung PE=3 SV=1 | 114 | 340 | 9.0E-30 |
| sp|Q8NQU9|UNG_CORGL | Uracil-DNA glycosylase OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=ung PE=3 SV=1 | 116 | 340 | 3.0E-29 |
| sp|B5Z8Z4|UNG_HELPG | Uracil-DNA glycosylase OS=Helicobacter pylori (strain G27) GN=ung PE=3 SV=1 | 116 | 340 | 4.0E-29 |
| sp|B6JNI4|UNG_HELP2 | Uracil-DNA glycosylase OS=Helicobacter pylori (strain P12) GN=ung PE=3 SV=1 | 116 | 340 | 6.0E-29 |
| sp|Q9ZJN9|UNG_HELPJ | Uracil-DNA glycosylase OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=ung PE=3 SV=1 | 116 | 340 | 8.0E-29 |
| sp|P67078|UNG_TROWT | Uracil-DNA glycosylase OS=Tropheryma whipplei (strain Twist) GN=ung PE=3 SV=1 | 119 | 341 | 1.0E-28 |
| sp|P67079|UNG_TROW8 | Uracil-DNA glycosylase OS=Tropheryma whipplei (strain TW08/27) GN=ung PE=3 SV=1 | 119 | 341 | 1.0E-28 |
| sp|Q82MX6|UNG1_STRAW | Uracil-DNA glycosylase 1 OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=ung1 PE=3 SV=1 | 139 | 340 | 1.0E-28 |
| sp|P56397|UNG_HELPY | Uracil-DNA glycosylase OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=ung PE=3 SV=1 | 116 | 340 | 1.0E-28 |
| sp|Q17Z05|UNG_HELAH | Uracil-DNA glycosylase OS=Helicobacter acinonychis (strain Sheeba) GN=ung PE=3 SV=1 | 116 | 319 | 1.0E-28 |
| sp|Q1CRR1|UNG_HELPH | Uracil-DNA glycosylase OS=Helicobacter pylori (strain HPAG1) GN=ung PE=3 SV=1 | 116 | 319 | 2.0E-28 |
| sp|B2UVB0|UNG_HELPS | Uracil-DNA glycosylase OS=Helicobacter pylori (strain Shi470) GN=ung PE=3 SV=1 | 116 | 319 | 6.0E-28 |
| sp|A8LD98|UNG_FRASN | Uracil-DNA glycosylase OS=Frankia sp. (strain EAN1pec) GN=ung PE=3 SV=1 | 114 | 340 | 2.0E-26 |
| sp|Q5UPT2|UNG_MIMIV | Probable uracil-DNA glycosylase OS=Acanthamoeba polyphaga mimivirus GN=UNG PE=3 SV=1 | 109 | 329 | 8.0E-24 |
| sp|P75536|UNG_MYCPN | Uracil-DNA glycosylase OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129) GN=ung PE=3 SV=1 | 106 | 339 | 4.0E-21 |
| sp|P47343|UNG_MYCGE | Uracil-DNA glycosylase OS=Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195) GN=ung PE=3 SV=1 | 119 | 345 | 1.0E-19 |
| Localizations | Signals | Cytoplasm | Nucleus | Extracellular | Cell membrane | Mitochondrion | Plastid | Endoplasmic reticulum | Lysosome vacuole | Golgi apparatus | Peroxisome |
|---|---|---|---|---|---|---|---|---|---|---|---|
| Nucleus | Nuclear localization signal | 0.3051 | 0.8154 | 0.1913 | 0.0146 | 0.3481 | 0.0138 | 0.0606 | 0.0265 | 0.0461 | 0.0215 |
| Orthofinder run ID | 4 |
| Orthogroup | 3084 |
| Change Orthofinder run |
| Type of sequence | Sequence |
|---|---|
| Locus | Download genbank file of locus
Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded. |
| Protein | >Ophio5|2257 MLVPPLWLANSPLIAALSLSRFACRATSAGRLLGRRPTRLGLVNMSMLKRKSGSSLPAEAEAKKPKVNGSITSFF GAPKPKPGGTPAPPVSFDKQAWVAGLSAEHRELLNLEIETLDDSWLALLKDEVTSKEFLDLKRFLDRETAAGRKW FPPKEDVYSWSRHTPFGNVKVVVVGQDPYHNDNQAHGMAFSVRPPTPAPPSLRNVYIALNKDYPTFAPPANKGGL LIPWADRGVLMLNTCLTVRAHEANSHANRGWERFTQKVIDLVAQKRTRGVVFMAWGTPAGKRVQKVDKQRHLVLQ SVHPSPLSAARGFFDCGHFKKANEWLITRYGADGEIDWALTSGTTTKKAPAPVLAATSAAEIKADEAPQSDAASG PSAGRDAKADDDIGSEDEAALEEALSIVEAKA |
| Coding | >Ophio5|2257 ATGCTCGTCCCACCCCTCTGGCTCGCCAATTCGCCCTTGATAGCCGCCCTCAGTCTGTCCCGCTTTGCCTGCCGA GCTACCTCGGCCGGCAGACTCCTTGGCCGTCGTCCAACCCGTCTCGGACTCGTCAACATGTCGATGCTCAAGCGC AAGAGCGGCAGCTCTCTGCCCGCCGAGGCCGAAGCCAAAAAACCAAAGGTCAACGGCAGTATCACATCCTTCTTT GGTGCTCCGAAGCCCAAGCCTGGAGGCACACCCGCCCCTCCCGTCAGCTTCGACAAGCAGGCATGGGTTGCTGGT TTGTCGGCCGAGCACAGGGAGCTGCTCAACCTTGAGATTGAGACTCTCGACGACAGCTGGCTGGCGCTCTTGAAG GATGAGGTCACCAGCAAGGAATTCCTCGACCTCAAGAGGTTCCTCGACCGCGAGACGGCAGCCGGCAGAAAATGG TTTCCCCCGAAGGAGGACGTCTACTCTTGGTCTCGCCACACTCCTTTCGGCAATGTCAAGGTCGTAGTCGTCGGT CAGGACCCCTATCACAACGACAACCAGGCTCACGGCATGGCCTTTTCCGTCCGACCGCCCACCCCTGCACCACCG TCGCTGAGGAACGTGTACATTGCGCTCAACAAAGATTACCCTACCTTTGCGCCCCCTGCGAACAAAGGGGGCCTC TTGATCCCATGGGCCGACCGCGGCGTCCTCATGCTCAACACTTGCCTCACCGTTCGCGCTCATGAAGCCAACTCG CACGCCAACCGGGGCTGGGAGCGCTTCACGCAGAAAGTCATTGATCTCGTGGCGCAGAAGCGGACGCGTGGAGTC GTCTTCATGGCCTGGGGCACACCTGCGGGTAAGCGTGTGCAGAAGGTGGACAAGCAGCGACACTTGGTGCTGCAG AGCGTGCATCCCAGCCCCCTCAGCGCCGCGAGAGGCTTCTTTGACTGCGGCCATTTCAAAAAGGCCAATGAGTGG TTGATTACGAGATATGGTGCCGATGGCGAGATTGATTGGGCCTTGACGTCGGGCACGACGACCAAGAAGGCGCCT GCGCCAGTGTTGGCGGCCACGTCGGCTGCCGAAATCAAGGCTGACGAGGCGCCCCAAAGCGACGCTGCTTCTGGG CCGTCCGCCGGCAGAGACGCAAAGGCGGACGATGACATCGGCTCGGAGGATGAGGCCGCTCTCGAGGAGGCCCTC AGTATAGTCGAGGCAAAGGCC |
| Transcript | >Ophio5|2257 ATGCTCGTCCCACCCCTCTGGCTCGCCAATTCGCCCTTGATAGCCGCCCTCAGTCTGTCCCGCTTTGCCTGCCGA GCTACCTCGGCCGGCAGACTCCTTGGCCGTCGTCCAACCCGTCTCGGACTCGTCAACATGTCGATGCTCAAGCGC AAGAGCGGCAGCTCTCTGCCCGCCGAGGCCGAAGCCAAAAAACCAAAGGTCAACGGCAGTATCACATCCTTCTTT GGTGCTCCGAAGCCCAAGCCTGGAGGCACACCCGCCCCTCCCGTCAGCTTCGACAAGCAGGCATGGGTTGCTGGT TTGTCGGCCGAGCACAGGGAGCTGCTCAACCTTGAGATTGAGACTCTCGACGACAGCTGGCTGGCGCTCTTGAAG GATGAGGTCACCAGCAAGGAATTCCTCGACCTCAAGAGGTTCCTCGACCGCGAGACGGCAGCCGGCAGAAAATGG TTTCCCCCGAAGGAGGACGTCTACTCTTGGTCTCGCCACACTCCTTTCGGCAATGTCAAGGTCGTAGTCGTCGGT CAGGACCCCTATCACAACGACAACCAGGCTCACGGCATGGCCTTTTCCGTCCGACCGCCCACCCCTGCACCACCG TCGCTGAGGAACGTGTACATTGCGCTCAACAAAGATTACCCTACCTTTGCGCCCCCTGCGAACAAAGGGGGCCTC TTGATCCCATGGGCCGACCGCGGCGTCCTCATGCTCAACACTTGCCTCACCGTTCGCGCTCATGAAGCCAACTCG CACGCCAACCGGGGCTGGGAGCGCTTCACGCAGAAAGTCATTGATCTCGTGGCGCAGAAGCGGACGCGTGGAGTC GTCTTCATGGCCTGGGGCACACCTGCGGGTAAGCGTGTGCAGAAGGTGGACAAGCAGCGACACTTGGTGCTGCAG AGCGTGCATCCCAGCCCCCTCAGCGCCGCGAGAGGCTTCTTTGACTGCGGCCATTTCAAAAAGGCCAATGAGTGG TTGATTACGAGATATGGTGCCGATGGCGAGATTGATTGGGCCTTGACGTCGGGCACGACGACCAAGAAGGCGCCT GCGCCAGTGTTGGCGGCCACGTCGGCTGCCGAAATCAAGGCTGACGAGGCGCCCCAAAGCGACGCTGCTTCTGGG CCGTCCGCCGGCAGAGACGCAAAGGCGGACGATGACATCGGCTCGGAGGATGAGGCCGCTCTCGAGGAGGCCCTC AGTATAGTCGAGGCAAAGGCCTGA |
| Gene | >Ophio5|2257 ATGCTCGTCCCACCCCTCTGGCTCGCCAATTCGCCCTTGATAGCCGCCCTCAGTCTGTCCCGCTTTGCCTGCCGA GCTACCTCGGCCGGCAGACTCCTTGGCCGTCGTCCAACCCGTCTCGGACTCGTCAACATGTCGATGCTCAAGCGC AAGAGCGGCAGCTCTCTGCCCGCCGAGGCCGAAGCCAAAAAACCAAAGGTCAACGGCAGTATCACATCCTTCTTT GGTGCTCCGAAGCCCAAGCCTGGAGGCACACCCGCCCCTCCCGTCAGCTTCGACAAGCAGGCATGGGTTGCTGGT TTGTCGGCCGAGCACAGGGAGCTGCTCAACCTTGAGATTGAGACTCTCGACGACAGCTGGCTGGCGCTCTTGAAG GATGAGGTCACCAGCAAGGAATTCCTCGACCTCAAGAGGTTCCTCGACCGCGAGACGGCAGCCGGCAGAAAATGG TTTCCCCCGAAGGAGGACGTCTACTCTTGGTGCGTCATGACGGCTAGACTCAACCCTCCTCCGCAGGGCGAGACT CGTGTCTGACCGGCCCGCTTCAGGTCTCGCCACACTCCTTTCGGCAATGTCAAGGTCGTAGTCGTCGGTCAGGAC CCCTATCACAACGACAACCAGGCTCACGGCATGGCCTTTTCCGTCCGACCGCCCACCCCTGCACCACCGTCGCTG AGGAACGTGTACATTGCGCTCAACAAAGATTACCCTACCTTTGCGCCCCCTGCGAACAAAGGGGGCCTCTTGATC CCATGGGCCGACCGCGGCGTCCTCATGCTCAACACTTGCCTCACCGTTCGCGCTCATGAAGCCAACTCGCACGCC AACCGGGGCTGGGAGCGCTTCACGCAGAAAGTCATTGATCTCGTGGCGCAGAAGCGGACGCGTGGAGTCGTCTTC ATGGCCTGGGGCACACCTGCGGGTAAGCGTGTGCAGAAGGTGGACAAGCAGCGACACTTGGTGCTGCAGAGCGTG CATCCCAGCCCCCTCAGCGCCGCGAGAGGCTTCTTTGACTGCGGCCATTTCAAAAAGGCCAATGAGTGGTTGATT ACGAGATATGGTGCCGATGGCGAGATTGATTGGGCCTTGACGTCGGGCACGACGACCAAGAAGGCGCCTGCGCCA GTGTTGGCGGCCACGTCGGCTGCCGAAATCAAGGCTGACGAGGCGCCCCAAAGCGACGCTGCTTCTGGGCCGTCC GCCGGCAGAGACGCAAAGGCGGACGATGACATCGGCTCGGAGGATGAGGCCGCTCTCGAGGAGGCCCTCAGTATA GTCGAGGCAAAGGCCTGA |