Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|2257
Gene name
Locationscaffold_193:22468..23761
Strand-
Gene length (bp)1293
Transcript length (bp)1224
Coding sequence length (bp)1221
Protein length (aa) 407

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03167 UDG Uracil DNA glycosylase superfamily 9.6E-23 167 325

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O74834|UNG_SCHPO Uracil-DNA glycosylase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ung1 PE=3 SV=1 92 347 3.0E-96
sp|P12887|UNG_YEAST Uracil-DNA glycosylase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=UNG1 PE=1 SV=1 88 349 5.0E-84
sp|Q182G9|UNG_PEPD6 Uracil-DNA glycosylase OS=Peptoclostridium difficile (strain 630) GN=ung PE=3 SV=1 115 342 3.0E-69
sp|A4IWI7|UNG_FRATW Uracil-DNA glycosylase OS=Francisella tularensis subsp. tularensis (strain WY96-3418) GN=ung PE=3 SV=1 119 340 9.0E-66
sp|Q5NEP2|UNG_FRATT Uracil-DNA glycosylase OS=Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4) GN=ung PE=3 SV=1 119 340 9.0E-66
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O74834|UNG_SCHPO Uracil-DNA glycosylase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ung1 PE=3 SV=1 92 347 3.0E-96
sp|P12887|UNG_YEAST Uracil-DNA glycosylase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=UNG1 PE=1 SV=1 88 349 5.0E-84
sp|Q182G9|UNG_PEPD6 Uracil-DNA glycosylase OS=Peptoclostridium difficile (strain 630) GN=ung PE=3 SV=1 115 342 3.0E-69
sp|A4IWI7|UNG_FRATW Uracil-DNA glycosylase OS=Francisella tularensis subsp. tularensis (strain WY96-3418) GN=ung PE=3 SV=1 119 340 9.0E-66
sp|Q5NEP2|UNG_FRATT Uracil-DNA glycosylase OS=Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4) GN=ung PE=3 SV=1 119 340 9.0E-66
sp|B2SFW5|UNG_FRATM Uracil-DNA glycosylase OS=Francisella tularensis subsp. mediasiatica (strain FSC147) GN=ung PE=3 SV=1 119 340 9.0E-66
sp|Q14G45|UNG_FRAT1 Uracil-DNA glycosylase OS=Francisella tularensis subsp. tularensis (strain FSC 198) GN=ung PE=3 SV=1 119 340 9.0E-66
sp|A8AD07|UNG_CITK8 Uracil-DNA glycosylase OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=ung PE=3 SV=1 117 338 2.0E-65
sp|Q6D208|UNG_PECAS Uracil-DNA glycosylase OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=ung PE=3 SV=1 119 338 2.0E-65
sp|Q0TEQ8|UNG_ECOL5 Uracil-DNA glycosylase OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=ung PE=3 SV=1 119 338 2.0E-65
sp|B7NRN6|UNG_ECO7I Uracil-DNA glycosylase OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=ung PE=3 SV=1 119 338 2.0E-65
sp|Q0BN28|UNG_FRATO Uracil-DNA glycosylase OS=Francisella tularensis subsp. holarctica (strain OSU18) GN=ung PE=3 SV=1 119 340 3.0E-65
sp|Q2A4Q4|UNG_FRATH Uracil-DNA glycosylase OS=Francisella tularensis subsp. holarctica (strain LVS) GN=ung PE=3 SV=1 119 340 3.0E-65
sp|A7NAN4|UNG_FRATF Uracil-DNA glycosylase OS=Francisella tularensis subsp. holarctica (strain FTNF002-00 / FTA) GN=ung PE=3 SV=1 119 340 3.0E-65
sp|Q1R8F2|UNG_ECOUT Uracil-DNA glycosylase OS=Escherichia coli (strain UTI89 / UPEC) GN=ung PE=3 SV=1 119 338 5.0E-65
sp|B1LP93|UNG_ECOSM Uracil-DNA glycosylase OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=ung PE=3 SV=1 119 338 5.0E-65
sp|A1AEB0|UNG_ECOK1 Uracil-DNA glycosylase OS=Escherichia coli O1:K1 / APEC GN=ung PE=3 SV=1 119 338 5.0E-65
sp|B7MIR5|UNG_ECO45 Uracil-DNA glycosylase OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=ung PE=3 SV=1 119 338 5.0E-65
sp|B7UH19|UNG_ECO27 Uracil-DNA glycosylase OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=ung PE=3 SV=1 119 338 5.0E-65
sp|A7ZQ25|UNG_ECO24 Uracil-DNA glycosylase OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=ung PE=3 SV=1 119 338 5.0E-65
sp|B7LUY5|UNG_ESCF3 Uracil-DNA glycosylase OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=ung PE=3 SV=1 119 338 5.0E-65
sp|A6TCJ2|UNG_KLEP7 Uracil-DNA glycosylase OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=ung PE=3 SV=1 119 338 6.0E-65
sp|B7MYL3|UNG_ECO81 Uracil-DNA glycosylase OS=Escherichia coli O81 (strain ED1a) GN=ung PE=3 SV=1 119 338 7.0E-65
sp|C6DC11|UNG_PECCP Uracil-DNA glycosylase OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=ung PE=3 SV=1 119 338 7.0E-65
sp|Q3YYT5|UNG_SHISS Uracil-DNA glycosylase OS=Shigella sonnei (strain Ss046) GN=ung PE=3 SV=1 119 338 8.0E-65
sp|Q31XQ4|UNG_SHIBS Uracil-DNA glycosylase OS=Shigella boydii serotype 4 (strain Sb227) GN=ung PE=3 SV=1 119 338 8.0E-65
sp|B2TYK1|UNG_SHIB3 Uracil-DNA glycosylase OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=ung PE=3 SV=1 119 338 8.0E-65
sp|B6I5F5|UNG_ECOSE Uracil-DNA glycosylase OS=Escherichia coli (strain SE11) GN=ung PE=3 SV=1 119 338 8.0E-65
sp|P12295|UNG_ECOLI Uracil-DNA glycosylase OS=Escherichia coli (strain K12) GN=ung PE=1 SV=2 119 338 8.0E-65
sp|B1IVP7|UNG_ECOLC Uracil-DNA glycosylase OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=ung PE=3 SV=1 119 338 8.0E-65
sp|A8A392|UNG_ECOHS Uracil-DNA glycosylase OS=Escherichia coli O9:H4 (strain HS) GN=ung PE=3 SV=1 119 338 8.0E-65
sp|B1XBQ7|UNG_ECODH Uracil-DNA glycosylase OS=Escherichia coli (strain K12 / DH10B) GN=ung PE=3 SV=1 119 338 8.0E-65
sp|C4ZYK3|UNG_ECOBW Uracil-DNA glycosylase OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=ung PE=3 SV=1 119 338 8.0E-65
sp|B7M8J5|UNG_ECO8A Uracil-DNA glycosylase OS=Escherichia coli O8 (strain IAI1) GN=ung PE=3 SV=1 119 338 8.0E-65
sp|B7LDH3|UNG_ECO55 Uracil-DNA glycosylase OS=Escherichia coli (strain 55989 / EAEC) GN=ung PE=3 SV=1 119 338 8.0E-65
sp|Q0T1S6|UNG_SHIF8 Uracil-DNA glycosylase OS=Shigella flexneri serotype 5b (strain 8401) GN=ung PE=3 SV=1 119 338 1.0E-64
sp|A0Q7Y8|UNG_FRATN Uracil-DNA glycosylase OS=Francisella tularensis subsp. novicida (strain U112) GN=ung PE=3 SV=1 119 340 2.0E-64
sp|Q32CT9|UNG_SHIDS Uracil-DNA glycosylase OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=ung PE=3 SV=1 119 338 3.0E-64
sp|B7N6H1|UNG_ECOLU Uracil-DNA glycosylase OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=ung PE=3 SV=1 119 338 3.0E-64
sp|B5Z154|UNG_ECO5E Uracil-DNA glycosylase OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=ung PE=3 SV=1 119 338 3.0E-64
sp|Q8X444|UNG_ECO57 Uracil-DNA glycosylase OS=Escherichia coli O157:H7 GN=ung PE=3 SV=3 119 338 3.0E-64
sp|Q8FF08|UNG_ECOL6 Uracil-DNA glycosylase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=ung PE=3 SV=3 119 338 4.0E-64
sp|A4WDE9|UNG_ENT38 Uracil-DNA glycosylase OS=Enterobacter sp. (strain 638) GN=ung PE=3 SV=1 115 338 7.0E-64
sp|B5F228|UNG_SALA4 Uracil-DNA glycosylase OS=Salmonella agona (strain SL483) GN=ung PE=3 SV=1 119 338 2.0E-63
sp|B4F058|UNG_PROMH Uracil-DNA glycosylase OS=Proteus mirabilis (strain HI4320) GN=ung PE=3 SV=1 119 340 2.0E-63
sp|P67073|UNG_SALTY Uracil-DNA glycosylase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=ung PE=3 SV=2 119 338 3.0E-63
sp|P67074|UNG_SALTI Uracil-DNA glycosylase OS=Salmonella typhi GN=ung PE=3 SV=2 119 338 3.0E-63
sp|B4TS29|UNG_SALSV Uracil-DNA glycosylase OS=Salmonella schwarzengrund (strain CVM19633) GN=ung PE=3 SV=1 119 338 3.0E-63
sp|B5BAR7|UNG_SALPK Uracil-DNA glycosylase OS=Salmonella paratyphi A (strain AKU_12601) GN=ung PE=3 SV=1 119 338 3.0E-63
sp|C0PVZ2|UNG_SALPC Uracil-DNA glycosylase OS=Salmonella paratyphi C (strain RKS4594) GN=ung PE=3 SV=1 119 338 3.0E-63
sp|A9N0W3|UNG_SALPB Uracil-DNA glycosylase OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=ung PE=3 SV=1 119 338 3.0E-63
sp|Q5PLH8|UNG_SALPA Uracil-DNA glycosylase OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=ung PE=3 SV=1 119 338 3.0E-63
sp|B4T290|UNG_SALNS Uracil-DNA glycosylase OS=Salmonella newport (strain SL254) GN=ung PE=3 SV=1 119 338 3.0E-63
sp|B4TE28|UNG_SALHS Uracil-DNA glycosylase OS=Salmonella heidelberg (strain SL476) GN=ung PE=3 SV=1 119 338 3.0E-63
sp|B5RD62|UNG_SALG2 Uracil-DNA glycosylase OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=ung PE=3 SV=1 119 338 3.0E-63
sp|B5QTW1|UNG_SALEP Uracil-DNA glycosylase OS=Salmonella enteritidis PT4 (strain P125109) GN=ung PE=3 SV=1 119 338 3.0E-63
sp|B5FRD9|UNG_SALDC Uracil-DNA glycosylase OS=Salmonella dublin (strain CT_02021853) GN=ung PE=3 SV=1 119 338 3.0E-63
sp|Q57L54|UNG_SALCH Uracil-DNA glycosylase OS=Salmonella choleraesuis (strain SC-B67) GN=ung PE=3 SV=1 119 338 3.0E-63
sp|Q7N1U8|UNG_PHOLL Uracil-DNA glycosylase OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=ung PE=3 SV=1 119 326 3.0E-63
sp|C4LC44|UNG_TOLAT Uracil-DNA glycosylase OS=Tolumonas auensis (strain DSM 9187 / TA4) GN=ung PE=3 SV=1 118 340 4.0E-63
sp|B5XNF8|UNG_KLEP3 Uracil-DNA glycosylase OS=Klebsiella pneumoniae (strain 342) GN=ung PE=3 SV=1 115 338 5.0E-63
sp|B6J738|UNG_COXB1 Uracil-DNA glycosylase OS=Coxiella burnetii (strain CbuK_Q154) GN=ung PE=3 SV=1 118 340 6.0E-63
sp|Q83CW4|UNG_COXBU Uracil-DNA glycosylase OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=ung PE=1 SV=1 118 340 7.0E-63
sp|P43731|UNG_HAEIN Uracil-DNA glycosylase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=ung PE=3 SV=1 119 340 8.0E-63
sp|Q92CI1|UNG2_LISIN Uracil-DNA glycosylase 2 OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=ung2 PE=3 SV=1 116 342 8.0E-63
sp|C3LQD1|UNG_VIBCM Uracil-DNA glycosylase OS=Vibrio cholerae serotype O1 (strain M66-2) GN=ung PE=3 SV=1 119 326 4.0E-62
sp|Q9KPK8|UNG_VIBCH Uracil-DNA glycosylase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=ung PE=1 SV=1 119 326 4.0E-62
sp|A5F5R5|UNG_VIBC3 Uracil-DNA glycosylase OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=ung PE=3 SV=1 119 326 4.0E-62
sp|B6EKY3|UNG_ALISL Uracil-DNA glycosylase OS=Aliivibrio salmonicida (strain LFI1238) GN=ung PE=3 SV=1 116 339 8.0E-62
sp|B6J089|UNG_COXB2 Uracil-DNA glycosylase OS=Coxiella burnetii (strain CbuG_Q212) GN=ung PE=3 SV=1 118 340 8.0E-62
sp|Q8Y7P6|UNG2_LISMO Uracil-DNA glycosylase 2 OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=ung2 PE=3 SV=1 116 342 8.0E-62
sp|Q1I5T6|UNG_PSEE4 Uracil-DNA glycosylase OS=Pseudomonas entomophila (strain L48) GN=ung PE=3 SV=1 116 340 1.0E-61
sp|A9KCD5|UNG_COXBN Uracil-DNA glycosylase OS=Coxiella burnetii (strain Dugway 5J108-111) GN=ung PE=3 SV=2 118 340 1.0E-61
sp|Q3KGL4|UNG_PSEPF Uracil-DNA glycosylase OS=Pseudomonas fluorescens (strain Pf0-1) GN=ung PE=3 SV=1 116 340 2.0E-61
sp|Q4QPM6|UNG_HAEI8 Uracil-DNA glycosylase OS=Haemophilus influenzae (strain 86-028NP) GN=ung PE=3 SV=1 119 340 2.0E-61
sp|Q02HQ1|UNG_PSEAB Uracil-DNA glycosylase OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=ung PE=3 SV=1 116 340 3.0E-61
sp|Q9I5H9|UNG_PSEAE Uracil-DNA glycosylase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=ung PE=3 SV=1 116 340 5.0E-61
sp|B7UYZ2|UNG_PSEA8 Uracil-DNA glycosylase OS=Pseudomonas aeruginosa (strain LESB58) GN=ung PE=3 SV=1 116 340 5.0E-61
sp|A6VAM7|UNG_PSEA7 Uracil-DNA glycosylase OS=Pseudomonas aeruginosa (strain PA7) GN=ung PE=3 SV=1 116 340 5.0E-61
sp|C1DQR0|UNG_AZOVD Uracil-DNA glycosylase OS=Azotobacter vinelandii (strain DJ / ATCC BAA-1303) GN=ung PE=3 SV=1 116 340 5.0E-61
sp|A9MGV9|UNG_SALAR Uracil-DNA glycosylase OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=ung PE=3 SV=1 119 338 7.0E-61
sp|Q2NS03|UNG_SODGM Uracil-DNA glycosylase OS=Sodalis glossinidius (strain morsitans) GN=ung PE=3 SV=1 119 341 7.0E-61
sp|A5UBC0|UNG_HAEIE Uracil-DNA glycosylase OS=Haemophilus influenzae (strain PittEE) GN=ung PE=3 SV=1 145 340 9.0E-61
sp|B0BTB4|UNG_ACTPJ Uracil-DNA glycosylase OS=Actinobacillus pleuropneumoniae serotype 3 (strain JL03) GN=ung PE=3 SV=1 118 340 1.0E-60
sp|B3H0M4|UNG_ACTP7 Uracil-DNA glycosylase OS=Actinobacillus pleuropneumoniae serotype 7 (strain AP76) GN=ung PE=3 SV=1 118 340 1.0E-60
sp|A3MZ80|UNG_ACTP2 Uracil-DNA glycosylase OS=Actinobacillus pleuropneumoniae serotype 5b (strain L20) GN=ung PE=3 SV=1 118 340 1.0E-60
sp|A5W8H2|UNG_PSEP1 Uracil-DNA glycosylase OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=ung PE=3 SV=1 116 340 2.0E-60
sp|B0UWA7|UNG_HISS2 Uracil-DNA glycosylase OS=Histophilus somni (strain 2336) GN=ung PE=3 SV=1 118 340 2.0E-60
sp|Q0I271|UNG_HAES1 Uracil-DNA glycosylase OS=Haemophilus somnus (strain 129Pt) GN=ung PE=3 SV=1 118 340 2.0E-60
sp|C3KDS6|UNG_PSEFS Uracil-DNA glycosylase OS=Pseudomonas fluorescens (strain SBW25) GN=ung PE=3 SV=1 116 340 4.0E-60
sp|Q7MNR0|UNG_VIBVY Uracil-DNA glycosylase OS=Vibrio vulnificus (strain YJ016) GN=ung PE=3 SV=2 119 340 4.0E-60
sp|Q8DEP7|UNG_VIBVU Uracil-DNA glycosylase OS=Vibrio vulnificus (strain CMCP6) GN=ung PE=3 SV=1 119 340 4.0E-60
sp|B0TXF5|UNG_FRAP2 Uracil-DNA glycosylase OS=Francisella philomiragia subsp. philomiragia (strain ATCC 25017) GN=ung PE=3 SV=1 119 340 5.0E-60
sp|A1JKI8|UNG_YERE8 Uracil-DNA glycosylase OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=ung PE=3 SV=1 119 338 5.0E-60
sp|B2VEC7|UNG_ERWT9 Uracil-DNA glycosylase OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=ung PE=3 SV=1 119 338 5.0E-60
sp|Q87XE2|UNG_PSESM Uracil-DNA glycosylase OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=ung PE=3 SV=1 116 340 6.0E-60
sp|Q88N05|UNG_PSEPK Uracil-DNA glycosylase OS=Pseudomonas putida (strain KT2440) GN=ung PE=3 SV=1 116 340 6.0E-60
sp|A6VLV4|UNG_ACTSZ Uracil-DNA glycosylase OS=Actinobacillus succinogenes (strain ATCC 55618 / 130Z) GN=ung PE=3 SV=1 119 340 7.0E-60
sp|A8GI39|UNG_SERP5 Uracil-DNA glycosylase OS=Serratia proteamaculans (strain 568) GN=ung PE=3 SV=1 119 338 7.0E-60
sp|Q4ZPC2|UNG_PSEU2 Uracil-DNA glycosylase OS=Pseudomonas syringae pv. syringae (strain B728a) GN=ung PE=3 SV=1 116 340 1.0E-59
sp|Q87SC4|UNG_VIBPA Uracil-DNA glycosylase OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=ung PE=3 SV=1 119 340 2.0E-59
sp|Q720K2|UNG2_LISMF Uracil-DNA glycosylase 2 OS=Listeria monocytogenes serotype 4b (strain F2365) GN=ung2 PE=3 SV=1 116 342 2.0E-59
sp|B0U620|UNG_XYLFM Uracil-DNA glycosylase OS=Xylella fastidiosa (strain M12) GN=ung PE=3 SV=1 104 340 2.0E-59
sp|Q9PA28|UNG_XYLFA Uracil-DNA glycosylase OS=Xylella fastidiosa (strain 9a5c) GN=ung PE=3 SV=2 104 340 3.0E-59
sp|A1KU26|UNG_NEIMF Uracil-DNA glycosylase OS=Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18) GN=ung PE=3 SV=1 118 340 4.0E-59
sp|Q9JZA1|UNG_NEIMB Uracil-DNA glycosylase OS=Neisseria meningitidis serogroup B (strain MC58) GN=ung PE=3 SV=1 118 340 4.0E-59
sp|A9LZA2|UNG_NEIM0 Uracil-DNA glycosylase OS=Neisseria meningitidis serogroup C (strain 053442) GN=ung PE=3 SV=1 118 340 4.0E-59
sp|Q879Z0|UNG_XYLFT Uracil-DNA glycosylase OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=ung PE=3 SV=1 116 340 6.0E-59
sp|B2IAB2|UNG_XYLF2 Uracil-DNA glycosylase OS=Xylella fastidiosa (strain M23) GN=ung PE=3 SV=1 116 340 6.0E-59
sp|C4Z8Z2|UNG_EUBR3 Uracil-DNA glycosylase OS=Eubacterium rectale (strain ATCC 33656 / VPI 0990) GN=ung PE=3 SV=1 113 340 6.0E-59
sp|P13051|UNG_HUMAN Uracil-DNA glycosylase OS=Homo sapiens GN=UNG PE=1 SV=2 116 338 6.0E-59
sp|Q48ET5|UNG_PSE14 Uracil-DNA glycosylase OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=ung PE=3 SV=1 116 340 9.0E-59
sp|Q92LU5|UNG_RHIME Uracil-DNA glycosylase OS=Rhizobium meliloti (strain 1021) GN=ung PE=3 SV=1 116 340 1.0E-58
sp|Q30Q92|UNG_SULDN Uracil-DNA glycosylase OS=Sulfurimonas denitrificans (strain ATCC 33889 / DSM 1251) GN=ung PE=3 SV=1 108 329 1.0E-58
sp|B4RLL6|UNG_NEIG2 Uracil-DNA glycosylase OS=Neisseria gonorrhoeae (strain NCCP11945) GN=ung PE=3 SV=1 118 340 1.0E-58
sp|Q5F8I7|UNG_NEIG1 Uracil-DNA glycosylase OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=ung PE=3 SV=1 118 340 1.0E-58
sp|Q4KGS0|UNG_PSEF5 Uracil-DNA glycosylase OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=ung PE=3 SV=1 116 340 1.0E-58
sp|Q9JUC4|UNG_NEIMA Uracil-DNA glycosylase OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=ung PE=3 SV=1 118 340 3.0E-58
sp|P97931|UNG_MOUSE Uracil-DNA glycosylase OS=Mus musculus GN=Ung PE=1 SV=3 116 326 3.0E-58
sp|B0KV50|UNG_PSEPG Uracil-DNA glycosylase OS=Pseudomonas putida (strain GB-1) GN=ung PE=3 SV=1 116 340 4.0E-58
sp|Q5E2Y8|UNG_VIBF1 Uracil-DNA glycosylase OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=ung PE=3 SV=1 119 342 4.0E-58
sp|B8F6C3|UNG_HAEPS Uracil-DNA glycosylase OS=Haemophilus parasuis serovar 5 (strain SH0165) GN=ung PE=3 SV=1 118 340 5.0E-58
sp|Q5KUD0|UNG_GEOKA Uracil-DNA glycosylase OS=Geobacillus kaustophilus (strain HTA426) GN=ung PE=3 SV=1 115 342 5.0E-58
sp|B1J4J3|UNG_PSEPW Uracil-DNA glycosylase OS=Pseudomonas putida (strain W619) GN=ung PE=3 SV=1 116 340 7.0E-58
sp|A6M317|UNG_CLOB8 Uracil-DNA glycosylase OS=Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052) GN=ung PE=3 SV=1 114 340 9.0E-58
sp|B5FAJ7|UNG_VIBFM Uracil-DNA glycosylase OS=Vibrio fischeri (strain MJ11) GN=ung PE=3 SV=1 119 339 1.0E-57
sp|Q65DN9|UNG_BACLD Uracil-DNA glycosylase OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=ung PE=3 SV=1 114 340 1.0E-57
sp|A7MS85|UNG_VIBCB Uracil-DNA glycosylase OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=ung PE=3 SV=1 119 340 2.0E-57
sp|Q7VMC0|UNG_HAEDU Uracil-DNA glycosylase OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=ung PE=3 SV=1 118 340 2.0E-57
sp|Q0TUH0|UNG_CLOP1 Uracil-DNA glycosylase OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) GN=ung PE=3 SV=1 116 340 2.0E-57
sp|P57807|UNG_PASMU Uracil-DNA glycosylase OS=Pasteurella multocida (strain Pm70) GN=ung PE=3 SV=1 119 342 4.0E-57
sp|Q667T7|UNG_YERPS Uracil-DNA glycosylase OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=ung PE=3 SV=1 119 319 4.0E-57
sp|A4TKZ2|UNG_YERPP Uracil-DNA glycosylase OS=Yersinia pestis (strain Pestoides F) GN=ung PE=3 SV=1 119 319 4.0E-57
sp|Q1CKF8|UNG_YERPN Uracil-DNA glycosylase OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=ung PE=3 SV=1 119 319 4.0E-57
sp|A9R3Y6|UNG_YERPG Uracil-DNA glycosylase OS=Yersinia pestis bv. Antiqua (strain Angola) GN=ung PE=3 SV=1 119 319 4.0E-57
sp|Q8ZD85|UNG_YERPE Uracil-DNA glycosylase OS=Yersinia pestis GN=ung PE=3 SV=1 119 319 4.0E-57
sp|Q1C570|UNG_YERPA Uracil-DNA glycosylase OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=ung PE=3 SV=1 119 319 4.0E-57
sp|A7FFS4|UNG_YERP3 Uracil-DNA glycosylase OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=ung PE=3 SV=1 119 319 6.0E-57
sp|Q8EPH6|UNG_OCEIH Uracil-DNA glycosylase OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=ung PE=3 SV=1 116 340 7.0E-57
sp|Q65VN0|UNG_MANSM Uracil-DNA glycosylase OS=Mannheimia succiniciproducens (strain MBEL55E) GN=ung PE=3 SV=1 119 342 7.0E-57
sp|Q8XNR7|UNG_CLOPE Uracil-DNA glycosylase OS=Clostridium perfringens (strain 13 / Type A) GN=ung PE=3 SV=1 116 340 7.0E-57
sp|Q0SWB8|UNG_CLOPS Uracil-DNA glycosylase OS=Clostridium perfringens (strain SM101 / Type A) GN=ung PE=3 SV=1 116 340 1.0E-56
sp|B1JRB1|UNG_YERPY Uracil-DNA glycosylase OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=ung PE=3 SV=1 119 319 1.0E-56
sp|B2KA63|UNG_YERPB Uracil-DNA glycosylase OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=ung PE=3 SV=1 119 319 1.0E-56
sp|Q8EB78|UNG_SHEON Uracil-DNA glycosylase OS=Shewanella oneidensis (strain MR-1) GN=ung PE=3 SV=1 119 340 1.0E-56
sp|Q3BNI2|UNG_XANC5 Uracil-DNA glycosylase OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=ung PE=3 SV=1 116 340 1.0E-56
sp|A6UDC0|UNG_SINMW Uracil-DNA glycosylase OS=Sinorhizobium medicae (strain WSM419) GN=ung PE=3 SV=1 116 340 1.0E-56
sp|Q6F9Y2|UNG_ACIAD Uracil-DNA glycosylase OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=ung PE=3 SV=1 116 340 2.0E-56
sp|Q8PFZ6|UNG_XANAC Uracil-DNA glycosylase OS=Xanthomonas axonopodis pv. citri (strain 306) GN=ung PE=3 SV=1 116 340 3.0E-56
sp|A9KP29|UNG_CLOPH Uracil-DNA glycosylase OS=Clostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg) GN=ung PE=3 SV=1 113 342 5.0E-56
sp|B0BA61|UNG_CHLTB Uracil-DNA glycosylase OS=Chlamydia trachomatis serovar L2b (strain UCH-1/proctitis) GN=ung PE=3 SV=1 113 340 6.0E-56
sp|B0B8I2|UNG_CHLT2 Uracil-DNA glycosylase OS=Chlamydia trachomatis serovar L2 (strain 434/Bu / ATCC VR-902B) GN=ung PE=3 SV=1 113 340 6.0E-56
sp|A0KMZ1|UNG_AERHH Uracil-DNA glycosylase OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=ung PE=3 SV=1 118 338 7.0E-56
sp|Q8P4D7|UNG_XANCP Uracil-DNA glycosylase OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=ung PE=3 SV=1 116 342 8.0E-56
sp|B0RWT2|UNG_XANCB Uracil-DNA glycosylase OS=Xanthomonas campestris pv. campestris (strain B100) GN=ung PE=3 SV=1 116 342 8.0E-56
sp|Q4UPY9|UNG_XANC8 Uracil-DNA glycosylase OS=Xanthomonas campestris pv. campestris (strain 8004) GN=ung PE=3 SV=1 116 342 8.0E-56
sp|A4ITQ2|UNG_GEOTN Uracil-DNA glycosylase OS=Geobacillus thermodenitrificans (strain NG80-2) GN=ung PE=3 SV=1 115 342 9.0E-56
sp|B7GMM1|UNG_ANOFW Uracil-DNA glycosylase OS=Anoxybacillus flavithermus (strain DSM 21510 / WK1) GN=ung PE=3 SV=1 113 342 1.0E-55
sp|Q9K3Z0|UNG2_STRCO Uracil-DNA glycosylase 2 OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=ung2 PE=3 SV=1 112 340 2.0E-55
sp|Q9PJD2|UNG_CHLMU Uracil-DNA glycosylase OS=Chlamydia muridarum (strain MoPn / Nigg) GN=ung PE=3 SV=1 113 340 2.0E-55
sp|Q5GUS2|UNG_XANOR Uracil-DNA glycosylase OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=ung PE=3 SV=1 116 340 3.0E-55
sp|B2SJF5|UNG_XANOP Uracil-DNA glycosylase OS=Xanthomonas oryzae pv. oryzae (strain PXO99A) GN=ung PE=3 SV=1 116 340 3.0E-55
sp|Q2NY21|UNG_XANOM Uracil-DNA glycosylase OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=ung PE=3 SV=1 116 340 3.0E-55
sp|Q827B3|UNG2_STRAW Uracil-DNA glycosylase 2 OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=ung2 PE=3 SV=1 116 340 3.0E-55
sp|Q24YA3|UNG_DESHY Uracil-DNA glycosylase OS=Desulfitobacterium hafniense (strain Y51) GN=ung PE=3 SV=1 113 340 4.0E-55
sp|B8FSV8|UNG_DESHD Uracil-DNA glycosylase OS=Desulfitobacterium hafniense (strain DCB-2 / DSM 10664) GN=ung PE=3 SV=1 113 340 4.0E-55
sp|P39615|UNG_BACSU Uracil-DNA glycosylase OS=Bacillus subtilis (strain 168) GN=ung PE=1 SV=1 114 340 8.0E-55
sp|O84613|UNG_CHLTR Uracil-DNA glycosylase OS=Chlamydia trachomatis (strain D/UW-3/Cx) GN=ung PE=3 SV=1 113 340 9.0E-55
sp|Q3KL88|UNG_CHLTA Uracil-DNA glycosylase OS=Chlamydia trachomatis serovar A (strain ATCC VR-571B / DSM 19440 / HAR-13) GN=ung PE=3 SV=1 113 340 9.0E-55
sp|A7GVE5|UNG_BACCN Uracil-DNA glycosylase OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=ung PE=3 SV=1 114 340 1.0E-54
sp|Q9RWH9|UNG_DEIRA Uracil-DNA glycosylase OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=ung PE=1 SV=1 115 347 1.0E-54
sp|Q8UCM8|UNG_AGRFC Uracil-DNA glycosylase OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=ung PE=3 SV=1 116 340 2.0E-54
sp|P29950|UNG_PSEDE Uracil-DNA glycosylase (Fragment) OS=Pseudomonas denitrificans GN=ung PE=3 SV=1 127 340 2.0E-54
sp|Q630K2|UNG_BACCZ Uracil-DNA glycosylase OS=Bacillus cereus (strain ZK / E33L) GN=ung PE=3 SV=1 114 340 2.0E-54
sp|Q81JQ4|UNG_BACAN Uracil-DNA glycosylase OS=Bacillus anthracis GN=ung PE=3 SV=1 115 340 2.0E-54
sp|C3LFS7|UNG_BACAC Uracil-DNA glycosylase OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=ung PE=3 SV=1 115 340 2.0E-54
sp|C3P2F8|UNG_BACAA Uracil-DNA glycosylase OS=Bacillus anthracis (strain A0248) GN=ung PE=3 SV=1 115 340 2.0E-54
sp|B9IS32|UNG_BACCQ Uracil-DNA glycosylase OS=Bacillus cereus (strain Q1) GN=ung PE=3 SV=1 115 340 3.0E-54
sp|B7HYF9|UNG_BACC7 Uracil-DNA glycosylase OS=Bacillus cereus (strain AH187) GN=ung PE=3 SV=1 115 340 3.0E-54
sp|Q814M9|UNG_BACCR Uracil-DNA glycosylase OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=ung PE=3 SV=1 115 340 3.0E-54
sp|B7HG60|UNG_BACC4 Uracil-DNA glycosylase OS=Bacillus cereus (strain B4264) GN=ung PE=3 SV=1 115 340 3.0E-54
sp|Q72X51|UNG_BACC1 Uracil-DNA glycosylase OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=ung PE=3 SV=1 115 340 4.0E-54
sp|Q8A5V6|UNG_BACTN Uracil-DNA glycosylase OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) GN=ung PE=3 SV=1 109 338 5.0E-54
sp|B7IRS8|UNG_BACC2 Uracil-DNA glycosylase OS=Bacillus cereus (strain G9842) GN=ung PE=3 SV=1 115 340 6.0E-54
sp|A7ZA24|UNG_BACMF Uracil-DNA glycosylase OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=ung PE=3 SV=1 114 340 6.0E-54
sp|Q64PM3|UNG2_BACFR Uracil-DNA glycosylase 2 OS=Bacteroides fragilis (strain YCH46) GN=ung2 PE=3 SV=1 109 338 7.0E-54
sp|Q5L9D9|UNG2_BACFN Uracil-DNA glycosylase 2 OS=Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / JCM 11019 / NCTC 9343) GN=ung2 PE=3 SV=1 109 338 7.0E-54
sp|C5D9T3|UNG_GEOSW Uracil-DNA glycosylase OS=Geobacillus sp. (strain WCH70) GN=ung PE=3 SV=1 115 342 7.0E-54
sp|A4SK71|UNG_AERS4 Uracil-DNA glycosylase OS=Aeromonas salmonicida (strain A449) GN=ung PE=3 SV=1 119 343 8.0E-54
sp|A9VSJ0|UNG_BACWK Uracil-DNA glycosylase OS=Bacillus weihenstephanensis (strain KBAB4) GN=ung PE=3 SV=1 116 340 1.0E-53
sp|Q6GJ88|UNG_STAAR Uracil-DNA glycosylase OS=Staphylococcus aureus (strain MRSA252) GN=ung PE=1 SV=1 120 326 1.0E-53
sp|Q2YS83|UNG_STAAB Uracil-DNA glycosylase OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=ung PE=3 SV=1 120 326 1.0E-53
sp|A8FIM7|UNG_BACP2 Uracil-DNA glycosylase OS=Bacillus pumilus (strain SAFR-032) GN=ung PE=3 SV=1 116 340 1.0E-53
sp|C1CXS7|UNG_DEIDV Uracil-DNA glycosylase OS=Deinococcus deserti (strain VCD115 / DSM 17065 / LMG 22923) GN=ung PE=3 SV=1 116 340 1.0E-53
sp|Q5WAZ9|UNG_BACSK Uracil-DNA glycosylase OS=Bacillus clausii (strain KSM-K16) GN=ung PE=3 SV=1 115 340 1.0E-53
sp|P67077|UNG_STAAW Uracil-DNA glycosylase OS=Staphylococcus aureus (strain MW2) GN=ung PE=3 SV=1 120 326 2.0E-53
sp|A8YZS8|UNG_STAAT Uracil-DNA glycosylase OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=ung PE=3 SV=1 120 326 2.0E-53
sp|P67076|UNG_STAAN Uracil-DNA glycosylase OS=Staphylococcus aureus (strain N315) GN=ung PE=3 SV=1 120 326 2.0E-53
sp|P67075|UNG_STAAM Uracil-DNA glycosylase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=ung PE=3 SV=1 120 326 2.0E-53
sp|A6QEN4|UNG_STAAE Uracil-DNA glycosylase OS=Staphylococcus aureus (strain Newman) GN=ung PE=3 SV=1 120 326 2.0E-53
sp|Q5HI95|UNG_STAAC Uracil-DNA glycosylase OS=Staphylococcus aureus (strain COL) GN=ung PE=3 SV=1 120 326 2.0E-53
sp|A5IQD5|UNG_STAA9 Uracil-DNA glycosylase OS=Staphylococcus aureus (strain JH9) GN=ung PE=3 SV=1 120 326 2.0E-53
sp|Q2G0J7|UNG_STAA8 Uracil-DNA glycosylase OS=Staphylococcus aureus (strain NCTC 8325) GN=ung PE=3 SV=1 120 326 2.0E-53
sp|Q2FJ62|UNG_STAA3 Uracil-DNA glycosylase OS=Staphylococcus aureus (strain USA300) GN=ung PE=3 SV=1 120 326 2.0E-53
sp|A6TZ58|UNG_STAA2 Uracil-DNA glycosylase OS=Staphylococcus aureus (strain JH1) GN=ung PE=3 SV=1 120 326 2.0E-53
sp|A7WZ22|UNG_STAA1 Uracil-DNA glycosylase OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=ung PE=3 SV=1 120 326 2.0E-53
sp|Q6GBQ6|UNG_STAAS Uracil-DNA glycosylase OS=Staphylococcus aureus (strain MSSA476) GN=ung PE=3 SV=1 120 326 2.0E-53
sp|Q6HAN7|UNG_BACHK Uracil-DNA glycosylase OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=ung PE=3 SV=1 115 340 3.0E-53
sp|C1EQ68|UNG_BACC3 Uracil-DNA glycosylase OS=Bacillus cereus (strain 03BB102) GN=ung PE=3 SV=1 115 340 4.0E-53
sp|A0RLI1|UNG_BACAH Uracil-DNA glycosylase OS=Bacillus thuringiensis (strain Al Hakam) GN=ung PE=3 SV=1 115 340 4.0E-53
sp|Q836Z5|UNG_ENTFA Uracil-DNA glycosylase OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=ung PE=3 SV=1 114 340 8.0E-53
sp|A6L7T5|UNG_BACV8 Uracil-DNA glycosylase OS=Bacteroides vulgatus (strain ATCC 8482 / DSM 1447 / NCTC 11154) GN=ung PE=3 SV=1 109 326 8.0E-53
sp|B1I012|UNG_LYSSC Uracil-DNA glycosylase OS=Lysinibacillus sphaericus (strain C3-41) GN=ung PE=3 SV=1 114 340 8.0E-53
sp|B2TQZ9|UNG_CLOBB Uracil-DNA glycosylase OS=Clostridium botulinum (strain Eklund 17B / Type B) GN=ung PE=3 SV=1 114 342 8.0E-53
sp|B2V017|UNG_CLOBA Uracil-DNA glycosylase OS=Clostridium botulinum (strain Alaska E43 / Type E3) GN=ung PE=3 SV=1 114 342 8.0E-53
sp|B9DKT3|UNG_STACT Uracil-DNA glycosylase OS=Staphylococcus carnosus (strain TM300) GN=ung PE=3 SV=1 119 339 1.0E-52
sp|A8MM35|UNG_ALKOO Uracil-DNA glycosylase OS=Alkaliphilus oremlandii (strain OhILAs) GN=ung PE=3 SV=1 116 342 1.0E-52
sp|B7JHM3|UNG_BACC0 Uracil-DNA glycosylase OS=Bacillus cereus (strain AH820) GN=ung PE=3 SV=1 115 340 1.0E-52
sp|Q7VRQ7|UNG_BLOFL Uracil-DNA glycosylase OS=Blochmannia floridanus GN=ung PE=3 SV=1 119 340 2.0E-52
sp|B0VMZ7|UNG_ACIBS Uracil-DNA glycosylase OS=Acinetobacter baumannii (strain SDF) GN=ung PE=3 SV=1 116 340 2.0E-52
sp|Q8R634|UNG_FUSNN Uracil-DNA glycosylase OS=Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131) GN=ung PE=3 SV=1 116 342 3.0E-52
sp|A3M500|UNG_ACIBT Uracil-DNA glycosylase OS=Acinetobacter baumannii (strain ATCC 17978 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377) GN=ung PE=3 SV=2 116 340 3.0E-52
sp|B2HZE0|UNG_ACIBC Uracil-DNA glycosylase OS=Acinetobacter baumannii (strain ACICU) GN=ung PE=3 SV=1 116 340 3.0E-52
sp|B0VD25|UNG_ACIBY Uracil-DNA glycosylase OS=Acinetobacter baumannii (strain AYE) GN=ung PE=3 SV=1 116 340 4.0E-52
sp|B7I526|UNG_ACIB5 Uracil-DNA glycosylase OS=Acinetobacter baumannii (strain AB0057) GN=ung PE=3 SV=1 116 340 4.0E-52
sp|B7H3L4|UNG_ACIB3 Uracil-DNA glycosylase OS=Acinetobacter baumannii (strain AB307-0294) GN=ung PE=3 SV=1 116 340 4.0E-52
sp|Q4L3Q7|UNG_STAHJ Uracil-DNA glycosylase OS=Staphylococcus haemolyticus (strain JCSC1435) GN=ung PE=3 SV=1 120 329 9.0E-52
sp|P69859|UNG_EHV1V Uracil-DNA glycosylase OS=Equine herpesvirus 1 (strain V592) GN=61 PE=3 SV=1 119 340 1.0E-51
sp|P28866|UNG_EHV1B Uracil-DNA glycosylase OS=Equine herpesvirus 1 (strain Ab4p) GN=61 PE=3 SV=1 119 340 1.0E-51
sp|Q49VD1|UNG_STAS1 Uracil-DNA glycosylase OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=ung PE=3 SV=1 120 326 3.0E-51
sp|Q03GV8|UNG_PEDPA Uracil-DNA glycosylase OS=Pediococcus pentosaceus (strain ATCC 25745 / 183-1w) GN=ung PE=3 SV=1 114 348 4.0E-51
sp|A0RM89|UNG_CAMFF Uracil-DNA glycosylase OS=Campylobacter fetus subsp. fetus (strain 82-40) GN=ung PE=3 SV=1 116 344 6.0E-51
sp|B2RHL6|UNG_PORG3 Uracil-DNA glycosylase OS=Porphyromonas gingivalis (strain ATCC 33277 / DSM 20709 / JCM 12257) GN=ung PE=3 SV=1 116 326 7.0E-51
sp|A7I0A8|UNG_CAMHC Uracil-DNA glycosylase OS=Campylobacter hominis (strain ATCC BAA-381 / LMG 19568 / NCTC 13146 / CH001A) GN=ung PE=3 SV=1 109 341 7.0E-51
sp|A1SUE5|UNG_PSYIN Uracil-DNA glycosylase OS=Psychromonas ingrahamii (strain 37) GN=ung PE=3 SV=1 119 329 8.0E-51
sp|Q1IWN1|UNG_DEIGD Uracil-DNA glycosylase OS=Deinococcus geothermalis (strain DSM 11300) GN=ung PE=3 SV=1 116 340 1.0E-50
sp|Q8CQ65|UNG_STAES Uracil-DNA glycosylase OS=Staphylococcus epidermidis (strain ATCC 12228) GN=ung PE=3 SV=1 120 329 2.0E-50
sp|Q5R080|UNG_IDILO Uracil-DNA glycosylase OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=ung PE=3 SV=1 120 326 4.0E-50
sp|Q9K682|UNG_BACHD Uracil-DNA glycosylase OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=ung PE=3 SV=1 113 340 4.0E-50
sp|A6TVW5|UNG_ALKMQ Uracil-DNA glycosylase OS=Alkaliphilus metalliredigens (strain QYMF) GN=ung PE=3 SV=1 113 340 4.0E-50
sp|A0M1V1|UNG_GRAFK Uracil-DNA glycosylase OS=Gramella forsetii (strain KT0803) GN=ung PE=3 SV=1 116 338 5.0E-50
sp|Q03KM6|UNG_STRTD Uracil-DNA glycosylase OS=Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9) GN=ung PE=3 SV=1 119 338 5.0E-50
sp|Q5HRG5|UNG_STAEQ Uracil-DNA glycosylase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=ung PE=3 SV=1 120 329 5.0E-50
sp|B8D787|UNG_BUCAT Uracil-DNA glycosylase OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain Tuc7) GN=ung PE=3 SV=1 119 341 5.0E-50
sp|P57280|UNG_BUCAI Uracil-DNA glycosylase OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=ung PE=3 SV=1 119 341 5.0E-50
sp|Q7MXF6|UNG_PORGI Uracil-DNA glycosylase OS=Porphyromonas gingivalis (strain ATCC BAA-308 / W83) GN=ung PE=3 SV=1 116 326 1.0E-49
sp|Q9LIH6|UNG_ARATH Uracil-DNA glycosylase, mitochondrial OS=Arabidopsis thaliana GN=UNG PE=1 SV=1 116 340 2.0E-49
sp|B2G626|UNG_LACRJ Uracil-DNA glycosylase OS=Lactobacillus reuteri (strain JCM 1112) GN=ung PE=3 SV=1 114 340 2.0E-49
sp|A5VIJ2|UNG_LACRD Uracil-DNA glycosylase OS=Lactobacillus reuteri (strain DSM 20016) GN=ung PE=3 SV=1 114 340 2.0E-49
sp|B9E8N2|UNG_MACCJ Uracil-DNA glycosylase OS=Macrococcus caseolyticus (strain JCSC5402) GN=ung PE=3 SV=1 127 339 2.0E-49
sp|Q3IG47|UNG_PSEHT Uracil-DNA glycosylase OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=ung PE=3 SV=1 120 326 3.0E-49
sp|A7ZAZ4|UNG_CAMC1 Uracil-DNA glycosylase OS=Campylobacter concisus (strain 13826) GN=ung PE=3 SV=1 109 342 3.0E-49
sp|Q07YI6|UNG_SHEFN Uracil-DNA glycosylase OS=Shewanella frigidimarina (strain NCIMB 400) GN=ung PE=3 SV=1 116 340 3.0E-49
sp|A7GVX1|UNG_CAMC5 Uracil-DNA glycosylase OS=Campylobacter curvus (strain 525.92) GN=ung PE=3 SV=1 109 342 2.0E-48
sp|B1YFL0|UNG_EXIS2 Uracil-DNA glycosylase OS=Exiguobacterium sibiricum (strain DSM 17290 / JCM 13490 / 255-15) GN=ung PE=3 SV=1 116 341 2.0E-48
sp|A5EVB8|UNG_DICNV Uracil-DNA glycosylase OS=Dichelobacter nodosus (strain VCS1703A) GN=ung PE=3 SV=1 116 329 6.0E-48
sp|Q64QI5|UNG1_BACFR Uracil-DNA glycosylase 1 OS=Bacteroides fragilis (strain YCH46) GN=ung1 PE=3 SV=1 109 338 1.0E-47
sp|Q5LA67|UNG1_BACFN Uracil-DNA glycosylase 1 OS=Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / JCM 11019 / NCTC 9343) GN=ung1 PE=3 SV=1 109 338 2.0E-47
sp|Q057V4|UNG_BUCCC Uracil-DNA glycosylase OS=Buchnera aphidicola subsp. Cinara cedri (strain Cc) GN=ung PE=3 SV=1 119 340 3.0E-47
sp|A7H1G3|UNG_CAMJD Uracil-DNA glycosylase OS=Campylobacter jejuni subsp. doylei (strain ATCC BAA-1458 / RM4099 / 269.97) GN=ung PE=3 SV=1 109 341 3.0E-47
sp|C0Z887|UNG_BREBN Uracil-DNA glycosylase OS=Brevibacillus brevis (strain 47 / JCM 6285 / NBRC 100599) GN=ung PE=3 SV=1 116 340 4.0E-47
sp|Q7P1I1|UNG_CHRVO Uracil-DNA glycosylase OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=ung PE=3 SV=1 120 329 5.0E-47
sp|A8FJP1|UNG_CAMJ8 Uracil-DNA glycosylase OS=Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828) GN=ung PE=3 SV=1 109 341 9.0E-47
sp|P59465|UNG_BUCBP Uracil-DNA glycosylase OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=ung PE=3 SV=1 104 340 1.0E-46
sp|Q5HX80|UNG_CAMJR Uracil-DNA glycosylase OS=Campylobacter jejuni (strain RM1221) GN=ung PE=3 SV=1 109 341 1.0E-46
sp|Q9PJ40|UNG_CAMJE Uracil-DNA glycosylase OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=ung PE=3 SV=1 109 341 1.0E-46
sp|P28275|UNG_HHV2H Uracil-DNA glycosylase OS=Human herpesvirus 2 (strain HG52) GN=UL2 PE=3 SV=1 116 340 1.0E-46
sp|Q315T1|UNG_DESAG Uracil-DNA glycosylase OS=Desulfovibrio alaskensis (strain G20) GN=ung PE=3 SV=1 151 329 1.0E-46
sp|P0A4P4|UNG_STRA5 Uracil-DNA glycosylase OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=ung PE=3 SV=1 119 338 1.0E-46
sp|P0A4P3|UNG_STRA3 Uracil-DNA glycosylase OS=Streptococcus agalactiae serotype III (strain NEM316) GN=ung PE=3 SV=1 119 338 1.0E-46
sp|P0A4P5|UNG_STRA1 Uracil-DNA glycosylase OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) GN=ung PE=3 SV=1 119 338 1.0E-46
sp|Q256I7|UNG_CHLFF Uracil-DNA glycosylase OS=Chlamydophila felis (strain Fe/C-56) GN=ung PE=3 SV=1 111 326 1.0E-46
sp|A1VXG9|UNG_CAMJJ Uracil-DNA glycosylase OS=Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176) GN=ung PE=3 SV=1 109 341 1.0E-46
sp|B2GAM7|UNG_LACF3 Uracil-DNA glycosylase OS=Lactobacillus fermentum (strain NBRC 3956 / LMG 18251) GN=ung PE=3 SV=1 114 342 1.0E-46
sp|B6YR15|UNG_AZOPC Uracil-DNA glycosylase OS=Azobacteroides pseudotrichonymphae genomovar. CFP2 GN=ung PE=3 SV=1 109 326 2.0E-46
sp|A5FFT1|UNG_FLAJ1 Uracil-DNA glycosylase OS=Flavobacterium johnsoniae (strain ATCC 17061 / DSM 2064 / UW101) GN=ung PE=3 SV=1 116 338 2.0E-46
sp|B3ERG6|UNG_AMOA5 Uracil-DNA glycosylase OS=Amoebophilus asiaticus (strain 5a2) GN=ung PE=3 SV=1 119 327 2.0E-46
sp|A8YUE7|UNG_LACH4 Uracil-DNA glycosylase OS=Lactobacillus helveticus (strain DPC 4571) GN=ung PE=3 SV=1 114 341 3.0E-46
sp|P10186|UNG_HHV11 Uracil-DNA glycosylase OS=Human herpesvirus 1 (strain 17) GN=UL2 PE=1 SV=1 116 340 3.0E-46
sp|A3CN85|UNG_STRSV Uracil-DNA glycosylase OS=Streptococcus sanguinis (strain SK36) GN=ung PE=3 SV=1 119 329 3.0E-46
sp|A4VV30|UNG_STRSY Uracil-DNA glycosylase OS=Streptococcus suis (strain 05ZYH33) GN=ung PE=3 SV=1 119 338 3.0E-46
sp|A4W1D5|UNG_STRS2 Uracil-DNA glycosylase OS=Streptococcus suis (strain 98HAH33) GN=ung PE=3 SV=1 119 338 3.0E-46
sp|Q5FL46|UNG_LACAC Uracil-DNA glycosylase OS=Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM) GN=ung PE=3 SV=1 114 340 4.0E-46
sp|Q5L4Q4|UNG_CHLAB Uracil-DNA glycosylase OS=Chlamydophila abortus (strain DSM 27085 / S26/3) GN=ung PE=3 SV=1 111 326 5.0E-46
sp|Q8DTV8|UNG_STRMU Uracil-DNA glycosylase OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=ung PE=3 SV=1 119 338 6.0E-46
sp|B1IBW9|UNG_STRPI Uracil-DNA glycosylase OS=Streptococcus pneumoniae (strain Hungary19A-6) GN=ung PE=3 SV=1 119 338 6.0E-46
sp|A8AXM4|UNG_STRGC Uracil-DNA glycosylase OS=Streptococcus gordonii (strain Challis / ATCC 35105 / CH1 / DL1 / V288) GN=ung PE=3 SV=1 119 329 6.0E-46
sp|B9KEK7|UNG_CAMLR Uracil-DNA glycosylase OS=Campylobacter lari (strain RM2100 / D67 / ATCC BAA-1060) GN=ung PE=3 SV=1 111 341 8.0E-46
sp|Q38VY5|UNG_LACSS Uracil-DNA glycosylase OS=Lactobacillus sakei subsp. sakei (strain 23K) GN=ung PE=3 SV=1 116 348 1.0E-45
sp|Q821F7|UNG_CHLCV Uracil-DNA glycosylase OS=Chlamydophila caviae (strain GPIC) GN=ung PE=3 SV=1 111 326 1.0E-45
sp|Q03SK6|UNG_LACBA Uracil-DNA glycosylase OS=Lactobacillus brevis (strain ATCC 367 / JCM 1170) GN=ung PE=3 SV=1 116 345 1.0E-45
sp|B2UDL1|UNG_RALPJ Uracil-DNA glycosylase OS=Ralstonia pickettii (strain 12J) GN=ung PE=3 SV=1 109 338 2.0E-45
sp|P53766|UNG_DICDI Uracil-DNA glycosylase OS=Dictyostelium discoideum GN=uglA PE=2 SV=2 110 341 2.0E-45
sp|B3WCZ5|UNG_LACCB Uracil-DNA glycosylase OS=Lactobacillus casei (strain BL23) GN=ung PE=3 SV=1 116 340 2.0E-45
sp|Q03AI1|UNG_LACC3 Uracil-DNA glycosylase OS=Lactobacillus casei (strain ATCC 334) GN=ung PE=3 SV=1 116 340 2.0E-45
sp|Q9Z7D3|UNG_CHLPN Uracil-DNA glycosylase OS=Chlamydia pneumoniae GN=ung PE=3 SV=1 114 340 2.0E-45
sp|P52506|UNG_SUHVF Uracil-DNA glycosylase OS=Suid herpesvirus 1 (strain Indiana-Funkhauser / Becker) GN=UL2 PE=3 SV=1 119 340 3.0E-45
sp|P52507|UNG_SUHVK Uracil-DNA glycosylase OS=Suid herpesvirus 1 (strain Kaplan) GN=UL2 PE=3 SV=1 119 340 3.0E-45
sp|Q9J3N2|UNG_VZVO Uracil-DNA glycosylase OS=Varicella-zoster virus (strain Oka vaccine) GN=ORF59 PE=3 SV=1 120 340 4.0E-45
sp|P09307|UNG_VZVD Uracil-DNA glycosylase OS=Varicella-zoster virus (strain Dumas) GN=ORF59 PE=3 SV=1 120 340 4.0E-45
sp|Q1GB22|UNG_LACDA Uracil-DNA glycosylase OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC 11842 / DSM 20081 / JCM 1002 / NBRC 13953 / NCIMB 11778) GN=ung PE=3 SV=1 116 340 5.0E-45
sp|Q04BG7|UNG_LACDB Uracil-DNA glycosylase OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC BAA-365) GN=ung PE=3 SV=1 116 344 7.0E-45
sp|B7J0Y9|UNG_BORBZ Uracil-DNA glycosylase OS=Borrelia burgdorferi (strain ZS7) GN=ung PE=3 SV=1 116 326 8.0E-45
sp|O51082|UNG_BORBU Uracil-DNA glycosylase OS=Borrelia burgdorferi (strain ATCC 35210 / B31 / CIP 102532 / DSM 4680) GN=ung PE=3 SV=1 116 326 8.0E-45
sp|P13158|UNG_HHV23 Uracil-DNA glycosylase OS=Human herpesvirus 2 (strain 333) GN=UL2 PE=2 SV=1 116 329 1.0E-44
sp|P12888|UNG_EBVB9 Uracil-DNA glycosylase OS=Epstein-Barr virus (strain B95-8) GN=UNG PE=1 SV=1 151 340 1.0E-44
sp|C1CRP5|UNG_STRZT Uracil-DNA glycosylase OS=Streptococcus pneumoniae (strain Taiwan19F-14) GN=ung PE=3 SV=1 119 338 1.0E-44
sp|C1CED4|UNG_STRZJ Uracil-DNA glycosylase OS=Streptococcus pneumoniae (strain JJA) GN=ung PE=3 SV=1 119 338 1.0E-44
sp|P23379|UNG_STRPN Uracil-DNA glycosylase OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=ung PE=3 SV=2 119 338 1.0E-44
sp|B8ZQ48|UNG_STRPJ Uracil-DNA glycosylase OS=Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1) GN=ung PE=3 SV=1 119 338 1.0E-44
sp|C1CKR8|UNG_STRZP Uracil-DNA glycosylase OS=Streptococcus pneumoniae (strain P1031) GN=ung PE=3 SV=1 119 338 1.0E-44
sp|Q8DPQ4|UNG_STRR6 Uracil-DNA glycosylase OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=ung PE=3 SV=2 119 338 1.0E-44
sp|B5E4R3|UNG_STRP4 Uracil-DNA glycosylase OS=Streptococcus pneumoniae serotype 19F (strain G54) GN=ung PE=3 SV=1 119 338 1.0E-44
sp|Q04KE2|UNG_STRP2 Uracil-DNA glycosylase OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=ung PE=3 SV=1 119 338 1.0E-44
sp|Q7MA00|UNG_WOLSU Uracil-DNA glycosylase OS=Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / LMG 7466 / NCTC 11488 / FDC 602W) GN=ung PE=3 SV=1 108 340 1.0E-44
sp|Q0SPB2|UNG_BORAP Uracil-DNA glycosylase OS=Borrelia afzelii (strain PKo) GN=ung PE=3 SV=1 113 326 2.0E-44
sp|Q74K70|UNG_LACJO Uracil-DNA glycosylase OS=Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533) GN=ung PE=3 SV=1 116 340 2.0E-44
sp|Q8XVE4|UNG_RALSO Uracil-DNA glycosylase OS=Ralstonia solanacearum (strain GMI1000) GN=ung PE=3 SV=1 112 338 2.0E-44
sp|A8EWN8|UNG_ARCB4 Uracil-DNA glycosylase OS=Arcobacter butzleri (strain RM4018) GN=ung PE=3 SV=1 119 326 2.0E-44
sp|Q92EQ0|UNG1_LISIN Uracil-DNA glycosylase 1 OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=ung1 PE=3 SV=1 119 342 4.0E-44
sp|Q662W1|UNG_BORBP Uracil-DNA glycosylase OS=Borrelia bavariensis (strain ATCC BAA-2496 / DSM 23469 / PBi) GN=ung PE=3 SV=1 116 326 4.0E-44
sp|Q9E6R2|UNG_GAHVM Uracil-DNA glycosylase OS=Gallid herpesvirus 2 (strain Chicken/Md5/ATCC VR-987) GN=MDV014 PE=3 SV=1 115 342 4.0E-44
sp|B2S1N8|UNG_BORHD Uracil-DNA glycosylase OS=Borrelia hermsii (strain HS1 / DAH) GN=ung PE=3 SV=1 116 326 5.0E-44
sp|P53764|UNG_BHV1C Uracil-DNA glycosylase OS=Bovine herpesvirus 1.1 (strain Cooper) GN=UL2 PE=3 SV=1 151 341 1.0E-43
sp|B5RKV2|UNG_BORDL Uracil-DNA glycosylase OS=Borrelia duttonii (strain Ly) GN=ung PE=3 SV=1 116 326 2.0E-43
sp|Q88YG1|UNG_LACPL Uracil-DNA glycosylase OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=ung PE=3 SV=1 116 340 2.0E-43
sp|Q723S4|UNG1_LISMF Uracil-DNA glycosylase 1 OS=Listeria monocytogenes serotype 4b (strain F2365) GN=ung1 PE=3 SV=1 119 342 8.0E-43
sp|B9DSB9|UNG_STRU0 Uracil-DNA glycosylase OS=Streptococcus uberis (strain ATCC BAA-854 / 0140J) GN=ung PE=3 SV=1 119 338 1.0E-42
sp|Q8Y9X7|UNG1_LISMO Uracil-DNA glycosylase 1 OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=ung1 PE=3 SV=1 119 341 1.0E-42
sp|B5RQN2|UNG_BORRA Uracil-DNA glycosylase OS=Borrelia recurrentis (strain A1) GN=ung PE=3 SV=1 116 326 1.0E-42
sp|Q98PV4|UNG_MYCPU Uracil-DNA glycosylase OS=Mycoplasma pulmonis (strain UAB CTIP) GN=ung PE=3 SV=1 117 340 1.0E-42
sp|A1QYK3|UNG_BORT9 Uracil-DNA glycosylase OS=Borrelia turicatae (strain 91E135) GN=ung PE=3 SV=1 116 326 2.0E-42
sp|B1MXY4|UNG_LEUCK Uracil-DNA glycosylase OS=Leuconostoc citreum (strain KM20) GN=ung PE=3 SV=1 119 338 3.0E-42
sp|O36395|UNG_ALHV1 Uracil-DNA glycosylase OS=Alcelaphine herpesvirus 1 (strain C500) GN=46 PE=3 SV=1 151 340 6.0E-42
sp|P53765|UNG_EHV2 Uracil-DNA glycosylase OS=Equine herpesvirus 2 (strain 86/87) GN=46 PE=3 SV=2 132 340 2.0E-40
sp|Q03W63|UNG_LEUMM Uracil-DNA glycosylase OS=Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / NCDO 523) GN=ung PE=3 SV=1 119 338 7.0E-40
sp|B4U3D4|UNG_STREM Uracil-DNA glycosylase OS=Streptococcus equi subsp. zooepidemicus (strain MGCS10565) GN=ung PE=3 SV=1 119 338 3.0E-39
sp|C0M7J9|UNG_STRE4 Uracil-DNA glycosylase OS=Streptococcus equi subsp. equi (strain 4047) GN=ung PE=3 SV=1 119 338 3.0E-39
sp|Q01019|UNG_SHV21 Uracil-DNA glycosylase OS=Saimiriine herpesvirus 2 (strain 11) GN=46 PE=3 SV=1 151 326 5.0E-39
sp|C0ME57|UNG_STRS7 Uracil-DNA glycosylase OS=Streptococcus equi subsp. zooepidemicus (strain H70) GN=ung PE=3 SV=1 119 338 6.0E-39
sp|B5XL20|UNG_STRPZ Uracil-DNA glycosylase OS=Streptococcus pyogenes serotype M49 (strain NZ131) GN=ung PE=3 SV=1 120 338 8.0E-39
sp|Q48U05|UNG_STRPM Uracil-DNA glycosylase OS=Streptococcus pyogenes serotype M28 (strain MGAS6180) GN=ung PE=3 SV=1 120 338 8.0E-39
sp|Q1JHA5|UNG_STRPD Uracil-DNA glycosylase OS=Streptococcus pyogenes serotype M2 (strain MGAS10270) GN=ung PE=3 SV=1 120 338 1.0E-38
sp|Q1JM60|UNG_STRPC Uracil-DNA glycosylase OS=Streptococcus pyogenes serotype M12 (strain MGAS9429) GN=ung PE=3 SV=1 120 338 1.0E-38
sp|Q1JC76|UNG_STRPB Uracil-DNA glycosylase OS=Streptococcus pyogenes serotype M12 (strain MGAS2096) GN=ung PE=3 SV=1 120 338 1.0E-38
sp|Q9A072|UNG_STRP1 Uracil-DNA glycosylase OS=Streptococcus pyogenes serotype M1 GN=ung PE=3 SV=1 120 338 1.0E-38
sp|A2RF00|UNG_STRPG Uracil-DNA glycosylase OS=Streptococcus pyogenes serotype M5 (strain Manfredo) GN=ung PE=3 SV=1 120 338 5.0E-38
sp|Q4A8N4|UNG_MYCH7 Uracil-DNA glycosylase OS=Mycoplasma hyopneumoniae (strain 7448) GN=ung PE=3 SV=1 119 340 8.0E-38
sp|Q1J724|UNG_STRPF Uracil-DNA glycosylase OS=Streptococcus pyogenes serotype M4 (strain MGAS10750) GN=ung PE=3 SV=1 120 338 1.0E-37
sp|P0DG75|UNG_STRPQ Uracil-DNA glycosylase OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=ung PE=3 SV=1 120 338 2.0E-37
sp|P0DG74|UNG_STRP3 Uracil-DNA glycosylase OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=ung PE=3 SV=1 120 338 2.0E-37
sp|Q5XCK3|UNG_STRP6 Uracil-DNA glycosylase OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=ung PE=3 SV=1 120 338 2.0E-37
sp|Q8P1B6|UNG_STRP8 Uracil-DNA glycosylase OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=ung PE=3 SV=1 120 338 2.0E-37
sp|Q1GHJ4|UNG_RUEST Uracil-DNA glycosylase OS=Ruegeria sp. (strain TM1040) GN=ung PE=3 SV=1 148 339 7.0E-37
sp|F5HI85|UNG_HCMVM Uracil-DNA glycosylase OS=Human cytomegalovirus (strain Merlin) GN=UL114 PE=3 SV=1 93 341 8.0E-37
sp|P16769|UL114_HCMVA Uracil-DNA glycosylase OS=Human cytomegalovirus (strain AD169) GN=UL114 PE=3 SV=1 93 341 8.0E-37
sp|F5HFA1|UNG_HHV8P Uracil-DNA glycosylase OS=Human herpesvirus 8 type P (isolate GK18) GN=ORF46 PE=3 SV=1 120 340 1.0E-36
sp|Q2L0Y2|UNG_BORA1 Uracil-DNA glycosylase OS=Bordetella avium (strain 197N) GN=ung PE=3 SV=1 169 351 1.0E-36
sp|Q9CBS3|UNG_MYCLE Uracil-DNA glycosylase OS=Mycobacterium leprae (strain TN) GN=ung PE=3 SV=1 114 340 2.0E-36
sp|B8ZS02|UNG_MYCLB Uracil-DNA glycosylase OS=Mycobacterium leprae (strain Br4923) GN=ung PE=3 SV=1 114 340 2.0E-36
sp|Q7VGS1|UNG_HELHP Uracil-DNA glycosylase OS=Helicobacter hepaticus (strain ATCC 51449 / 3B1) GN=ung PE=3 SV=1 109 326 6.0E-36
sp|Q21SE9|UNG_RHOFT Uracil-DNA glycosylase OS=Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118) GN=ung PE=3 SV=1 120 327 6.0E-36
sp|A9IGW1|UNG_BORPD Uracil-DNA glycosylase OS=Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448) GN=ung PE=3 SV=1 116 338 2.0E-35
sp|Q5YRZ2|UNG_NOCFA Uracil-DNA glycosylase OS=Nocardia farcinica (strain IFM 10152) GN=ung PE=3 SV=1 114 340 2.0E-35
sp|A0QJA9|UNG_MYCA1 Uracil-DNA glycosylase OS=Mycobacterium avium (strain 104) GN=ung PE=3 SV=1 114 340 4.0E-35
sp|Q73VJ7|UNG_MYCPA Uracil-DNA glycosylase OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=ung PE=3 SV=1 114 340 5.0E-35
sp|Q9PPU2|UNG_UREPA Uracil-DNA glycosylase OS=Ureaplasma parvum serovar 3 (strain ATCC 700970) GN=ung PE=3 SV=1 151 327 7.0E-35
sp|B1AJI8|UNG_UREP2 Uracil-DNA glycosylase OS=Ureaplasma parvum serovar 3 (strain ATCC 27815 / 27 / NCTC 11736) GN=ung PE=3 SV=1 151 327 7.0E-35
sp|Q1BAP2|UNG_MYCSS Uracil-DNA glycosylase OS=Mycobacterium sp. (strain MCS) GN=ung PE=3 SV=1 114 340 1.0E-34
sp|A1UEC0|UNG_MYCSK Uracil-DNA glycosylase OS=Mycobacterium sp. (strain KMS) GN=ung PE=3 SV=1 114 340 1.0E-34
sp|A3PXS4|UNG_MYCSJ Uracil-DNA glycosylase OS=Mycobacterium sp. (strain JLS) GN=ung PE=3 SV=1 114 340 1.0E-34
sp|A1SNW4|UNG_NOCSJ Uracil-DNA glycosylase OS=Nocardioides sp. (strain BAA-499 / JS614) GN=ung PE=3 SV=1 129 340 2.0E-34
sp|A0PQ07|UNG_MYCUA Uracil-DNA glycosylase OS=Mycobacterium ulcerans (strain Agy99) GN=ung PE=3 SV=1 114 340 2.0E-34
sp|B2HIJ2|UNG_MYCMM Uracil-DNA glycosylase OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=ung PE=3 SV=1 114 340 3.0E-34
sp|Q9CIX2|UNG_LACLA Uracil-DNA glycosylase OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=ung PE=3 SV=1 120 339 3.0E-34
sp|Q8G3E9|UNG_BIFLO Uracil-DNA glycosylase OS=Bifidobacterium longum (strain NCC 2705) GN=ung PE=3 SV=1 139 340 4.0E-34
sp|P50639|UNG_HHV7J Uracil-DNA glycosylase OS=Human herpesvirus 7 (strain JI) GN=U81 PE=3 SV=1 151 342 5.0E-34
sp|B5ZC55|UNG_UREU1 Uracil-DNA glycosylase OS=Ureaplasma urealyticum serovar 10 (strain ATCC 33699 / Western) GN=ung PE=3 SV=1 151 330 8.0E-34
sp|Q032L5|UNG_LACLS Uracil-DNA glycosylase OS=Lactococcus lactis subsp. cremoris (strain SK11) GN=ung PE=3 SV=1 120 339 8.0E-34
sp|A2RHW2|UNG_LACLM Uracil-DNA glycosylase OS=Lactococcus lactis subsp. cremoris (strain MG1363) GN=ung PE=3 SV=1 120 339 9.0E-34
sp|A0QV01|UNG_MYCS2 Uracil-DNA glycosylase OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=ung PE=3 SV=1 114 340 2.0E-33
sp|Q7W1Y7|UNG_BORPA Uracil-DNA glycosylase OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=ung PE=3 SV=1 120 348 1.0E-32
sp|Q7WQW5|UNG_BORBR Uracil-DNA glycosylase OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=ung PE=3 SV=1 120 348 1.0E-32
sp|Q7VUM8|UNG_BORPE Uracil-DNA glycosylase OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=ung PE=3 SV=1 120 348 3.0E-32
sp|A4TE31|UNG_MYCGI Uracil-DNA glycosylase OS=Mycobacterium gilvum (strain PYR-GCK) GN=ung PE=3 SV=1 114 340 3.0E-32
sp|P9WFQ9|UNG_MYCTU Uracil-DNA glycosylase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ung PE=1 SV=1 114 340 4.0E-32
sp|P9WFQ8|UNG_MYCTO Uracil-DNA glycosylase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ung PE=3 SV=1 114 340 4.0E-32
sp|A5U6Y7|UNG_MYCTA Uracil-DNA glycosylase OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=ung PE=3 SV=1 114 340 4.0E-32
sp|C1AG91|UNG_MYCBT Uracil-DNA glycosylase OS=Mycobacterium bovis (strain BCG / Tokyo 172 / ATCC 35737 / TMC 1019) GN=ung PE=3 SV=1 114 340 4.0E-32
sp|A1KMX0|UNG_MYCBP Uracil-DNA glycosylase OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=ung PE=3 SV=1 114 340 4.0E-32
sp|P67072|UNG_MYCBO Uracil-DNA glycosylase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ung PE=3 SV=1 114 340 4.0E-32
sp|A1T717|UNG_MYCVP Uracil-DNA glycosylase OS=Mycobacterium vanbaalenii (strain DSM 7251 / PYR-1) GN=ung PE=3 SV=1 114 340 5.0E-32
sp|P52345|UNG_HHV6U Uracil-DNA glycosylase OS=Human herpesvirus 6A (strain Uganda-1102) GN=U81 PE=3 SV=1 119 342 6.0E-32
sp|Q8FPQ4|UNG_COREF Uracil-DNA glycosylase OS=Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395) GN=ung PE=3 SV=1 119 340 1.0E-31
sp|P52447|UNG_HHV6Z Uracil-DNA glycosylase OS=Human herpesvirus 6B (strain Z29) GN=U81 PE=3 SV=1 152 342 2.0E-31
sp|Q6UDG6|UNG_PSHV1 Uracil-DNA glycosylase OS=Psittacid herpesvirus 1 (isolate Amazon parrot/-/97-0001/1997) GN=UL2 PE=3 SV=1 116 326 2.0E-31
sp|Q9EX12|UNG1_STRCO Uracil-DNA glycosylase 1 OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=ung1 PE=3 SV=1 114 340 2.0E-31
sp|Q47Q90|UNG_THEFY Uracil-DNA glycosylase OS=Thermobifida fusca (strain YX) GN=ung PE=3 SV=1 114 340 3.0E-31
sp|B1MDP0|UNG_MYCA9 Uracil-DNA glycosylase OS=Mycobacterium abscessus (strain ATCC 19977 / DSM 44196 / CIP 104536 / JCM 13569 / NCTC 13031 / TMC 1543) GN=ung PE=3 SV=1 114 340 9.0E-30
sp|Q8NQU9|UNG_CORGL Uracil-DNA glycosylase OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=ung PE=3 SV=1 116 340 3.0E-29
sp|B5Z8Z4|UNG_HELPG Uracil-DNA glycosylase OS=Helicobacter pylori (strain G27) GN=ung PE=3 SV=1 116 340 4.0E-29
sp|B6JNI4|UNG_HELP2 Uracil-DNA glycosylase OS=Helicobacter pylori (strain P12) GN=ung PE=3 SV=1 116 340 6.0E-29
sp|Q9ZJN9|UNG_HELPJ Uracil-DNA glycosylase OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=ung PE=3 SV=1 116 340 8.0E-29
sp|P67078|UNG_TROWT Uracil-DNA glycosylase OS=Tropheryma whipplei (strain Twist) GN=ung PE=3 SV=1 119 341 1.0E-28
sp|P67079|UNG_TROW8 Uracil-DNA glycosylase OS=Tropheryma whipplei (strain TW08/27) GN=ung PE=3 SV=1 119 341 1.0E-28
sp|Q82MX6|UNG1_STRAW Uracil-DNA glycosylase 1 OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=ung1 PE=3 SV=1 139 340 1.0E-28
sp|P56397|UNG_HELPY Uracil-DNA glycosylase OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=ung PE=3 SV=1 116 340 1.0E-28
sp|Q17Z05|UNG_HELAH Uracil-DNA glycosylase OS=Helicobacter acinonychis (strain Sheeba) GN=ung PE=3 SV=1 116 319 1.0E-28
sp|Q1CRR1|UNG_HELPH Uracil-DNA glycosylase OS=Helicobacter pylori (strain HPAG1) GN=ung PE=3 SV=1 116 319 2.0E-28
sp|B2UVB0|UNG_HELPS Uracil-DNA glycosylase OS=Helicobacter pylori (strain Shi470) GN=ung PE=3 SV=1 116 319 6.0E-28
sp|A8LD98|UNG_FRASN Uracil-DNA glycosylase OS=Frankia sp. (strain EAN1pec) GN=ung PE=3 SV=1 114 340 2.0E-26
sp|Q5UPT2|UNG_MIMIV Probable uracil-DNA glycosylase OS=Acanthamoeba polyphaga mimivirus GN=UNG PE=3 SV=1 109 329 8.0E-24
sp|P75536|UNG_MYCPN Uracil-DNA glycosylase OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129) GN=ung PE=3 SV=1 106 339 4.0E-21
sp|P47343|UNG_MYCGE Uracil-DNA glycosylase OS=Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195) GN=ung PE=3 SV=1 119 345 1.0E-19
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 17 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|2257
MLVPPLWLANSPLIAALSLSRFACRATSAGRLLGRRPTRLGLVNMSMLKRKSGSSLPAEAEAKKPKVNGSITSFF
GAPKPKPGGTPAPPVSFDKQAWVAGLSAEHRELLNLEIETLDDSWLALLKDEVTSKEFLDLKRFLDRETAAGRKW
FPPKEDVYSWSRHTPFGNVKVVVVGQDPYHNDNQAHGMAFSVRPPTPAPPSLRNVYIALNKDYPTFAPPANKGGL
LIPWADRGVLMLNTCLTVRAHEANSHANRGWERFTQKVIDLVAQKRTRGVVFMAWGTPAGKRVQKVDKQRHLVLQ
SVHPSPLSAARGFFDCGHFKKANEWLITRYGADGEIDWALTSGTTTKKAPAPVLAATSAAEIKADEAPQSDAASG
PSAGRDAKADDDIGSEDEAALEEALSIVEAKA
Coding >Ophio5|2257
ATGCTCGTCCCACCCCTCTGGCTCGCCAATTCGCCCTTGATAGCCGCCCTCAGTCTGTCCCGCTTTGCCTGCCGA
GCTACCTCGGCCGGCAGACTCCTTGGCCGTCGTCCAACCCGTCTCGGACTCGTCAACATGTCGATGCTCAAGCGC
AAGAGCGGCAGCTCTCTGCCCGCCGAGGCCGAAGCCAAAAAACCAAAGGTCAACGGCAGTATCACATCCTTCTTT
GGTGCTCCGAAGCCCAAGCCTGGAGGCACACCCGCCCCTCCCGTCAGCTTCGACAAGCAGGCATGGGTTGCTGGT
TTGTCGGCCGAGCACAGGGAGCTGCTCAACCTTGAGATTGAGACTCTCGACGACAGCTGGCTGGCGCTCTTGAAG
GATGAGGTCACCAGCAAGGAATTCCTCGACCTCAAGAGGTTCCTCGACCGCGAGACGGCAGCCGGCAGAAAATGG
TTTCCCCCGAAGGAGGACGTCTACTCTTGGTCTCGCCACACTCCTTTCGGCAATGTCAAGGTCGTAGTCGTCGGT
CAGGACCCCTATCACAACGACAACCAGGCTCACGGCATGGCCTTTTCCGTCCGACCGCCCACCCCTGCACCACCG
TCGCTGAGGAACGTGTACATTGCGCTCAACAAAGATTACCCTACCTTTGCGCCCCCTGCGAACAAAGGGGGCCTC
TTGATCCCATGGGCCGACCGCGGCGTCCTCATGCTCAACACTTGCCTCACCGTTCGCGCTCATGAAGCCAACTCG
CACGCCAACCGGGGCTGGGAGCGCTTCACGCAGAAAGTCATTGATCTCGTGGCGCAGAAGCGGACGCGTGGAGTC
GTCTTCATGGCCTGGGGCACACCTGCGGGTAAGCGTGTGCAGAAGGTGGACAAGCAGCGACACTTGGTGCTGCAG
AGCGTGCATCCCAGCCCCCTCAGCGCCGCGAGAGGCTTCTTTGACTGCGGCCATTTCAAAAAGGCCAATGAGTGG
TTGATTACGAGATATGGTGCCGATGGCGAGATTGATTGGGCCTTGACGTCGGGCACGACGACCAAGAAGGCGCCT
GCGCCAGTGTTGGCGGCCACGTCGGCTGCCGAAATCAAGGCTGACGAGGCGCCCCAAAGCGACGCTGCTTCTGGG
CCGTCCGCCGGCAGAGACGCAAAGGCGGACGATGACATCGGCTCGGAGGATGAGGCCGCTCTCGAGGAGGCCCTC
AGTATAGTCGAGGCAAAGGCC
Transcript >Ophio5|2257
ATGCTCGTCCCACCCCTCTGGCTCGCCAATTCGCCCTTGATAGCCGCCCTCAGTCTGTCCCGCTTTGCCTGCCGA
GCTACCTCGGCCGGCAGACTCCTTGGCCGTCGTCCAACCCGTCTCGGACTCGTCAACATGTCGATGCTCAAGCGC
AAGAGCGGCAGCTCTCTGCCCGCCGAGGCCGAAGCCAAAAAACCAAAGGTCAACGGCAGTATCACATCCTTCTTT
GGTGCTCCGAAGCCCAAGCCTGGAGGCACACCCGCCCCTCCCGTCAGCTTCGACAAGCAGGCATGGGTTGCTGGT
TTGTCGGCCGAGCACAGGGAGCTGCTCAACCTTGAGATTGAGACTCTCGACGACAGCTGGCTGGCGCTCTTGAAG
GATGAGGTCACCAGCAAGGAATTCCTCGACCTCAAGAGGTTCCTCGACCGCGAGACGGCAGCCGGCAGAAAATGG
TTTCCCCCGAAGGAGGACGTCTACTCTTGGTCTCGCCACACTCCTTTCGGCAATGTCAAGGTCGTAGTCGTCGGT
CAGGACCCCTATCACAACGACAACCAGGCTCACGGCATGGCCTTTTCCGTCCGACCGCCCACCCCTGCACCACCG
TCGCTGAGGAACGTGTACATTGCGCTCAACAAAGATTACCCTACCTTTGCGCCCCCTGCGAACAAAGGGGGCCTC
TTGATCCCATGGGCCGACCGCGGCGTCCTCATGCTCAACACTTGCCTCACCGTTCGCGCTCATGAAGCCAACTCG
CACGCCAACCGGGGCTGGGAGCGCTTCACGCAGAAAGTCATTGATCTCGTGGCGCAGAAGCGGACGCGTGGAGTC
GTCTTCATGGCCTGGGGCACACCTGCGGGTAAGCGTGTGCAGAAGGTGGACAAGCAGCGACACTTGGTGCTGCAG
AGCGTGCATCCCAGCCCCCTCAGCGCCGCGAGAGGCTTCTTTGACTGCGGCCATTTCAAAAAGGCCAATGAGTGG
TTGATTACGAGATATGGTGCCGATGGCGAGATTGATTGGGCCTTGACGTCGGGCACGACGACCAAGAAGGCGCCT
GCGCCAGTGTTGGCGGCCACGTCGGCTGCCGAAATCAAGGCTGACGAGGCGCCCCAAAGCGACGCTGCTTCTGGG
CCGTCCGCCGGCAGAGACGCAAAGGCGGACGATGACATCGGCTCGGAGGATGAGGCCGCTCTCGAGGAGGCCCTC
AGTATAGTCGAGGCAAAGGCCTGA
Gene >Ophio5|2257
ATGCTCGTCCCACCCCTCTGGCTCGCCAATTCGCCCTTGATAGCCGCCCTCAGTCTGTCCCGCTTTGCCTGCCGA
GCTACCTCGGCCGGCAGACTCCTTGGCCGTCGTCCAACCCGTCTCGGACTCGTCAACATGTCGATGCTCAAGCGC
AAGAGCGGCAGCTCTCTGCCCGCCGAGGCCGAAGCCAAAAAACCAAAGGTCAACGGCAGTATCACATCCTTCTTT
GGTGCTCCGAAGCCCAAGCCTGGAGGCACACCCGCCCCTCCCGTCAGCTTCGACAAGCAGGCATGGGTTGCTGGT
TTGTCGGCCGAGCACAGGGAGCTGCTCAACCTTGAGATTGAGACTCTCGACGACAGCTGGCTGGCGCTCTTGAAG
GATGAGGTCACCAGCAAGGAATTCCTCGACCTCAAGAGGTTCCTCGACCGCGAGACGGCAGCCGGCAGAAAATGG
TTTCCCCCGAAGGAGGACGTCTACTCTTGGTGCGTCATGACGGCTAGACTCAACCCTCCTCCGCAGGGCGAGACT
CGTGTCTGACCGGCCCGCTTCAGGTCTCGCCACACTCCTTTCGGCAATGTCAAGGTCGTAGTCGTCGGTCAGGAC
CCCTATCACAACGACAACCAGGCTCACGGCATGGCCTTTTCCGTCCGACCGCCCACCCCTGCACCACCGTCGCTG
AGGAACGTGTACATTGCGCTCAACAAAGATTACCCTACCTTTGCGCCCCCTGCGAACAAAGGGGGCCTCTTGATC
CCATGGGCCGACCGCGGCGTCCTCATGCTCAACACTTGCCTCACCGTTCGCGCTCATGAAGCCAACTCGCACGCC
AACCGGGGCTGGGAGCGCTTCACGCAGAAAGTCATTGATCTCGTGGCGCAGAAGCGGACGCGTGGAGTCGTCTTC
ATGGCCTGGGGCACACCTGCGGGTAAGCGTGTGCAGAAGGTGGACAAGCAGCGACACTTGGTGCTGCAGAGCGTG
CATCCCAGCCCCCTCAGCGCCGCGAGAGGCTTCTTTGACTGCGGCCATTTCAAAAAGGCCAATGAGTGGTTGATT
ACGAGATATGGTGCCGATGGCGAGATTGATTGGGCCTTGACGTCGGGCACGACGACCAAGAAGGCGCCTGCGCCA
GTGTTGGCGGCCACGTCGGCTGCCGAAATCAAGGCTGACGAGGCGCCCCAAAGCGACGCTGCTTCTGGGCCGTCC
GCCGGCAGAGACGCAAAGGCGGACGATGACATCGGCTCGGAGGATGAGGCCGCTCTCGAGGAGGCCCTCAGTATA
GTCGAGGCAAAGGCCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail