Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|2255
Gene name
Locationscaffold_193:16136..20825
Strand-
Gene length (bp)4689
Transcript length (bp)3819
Coding sequence length (bp)3816
Protein length (aa) 1272

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08101 Msb1-Mug8_dom Meiotically up-regulated protein Msb1/Mug8 domain 1.5E-164 284 749

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P21339|MSB1_YEAST Morphogenesis-related protein MSB1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MSB1 PE=1 SV=1 287 585 5.0E-32
sp|Q10326|MUG8_SCHPO Meiotically up-regulated gene 8 protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mug8 PE=1 SV=1 277 503 8.0E-10

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 44 0.45

Transmembrane Domains

Domain # Start End Length
1 170 189 19

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|2255
MCQRTGSALEVVVSYHGPDSKPDAVSAGLYLVVHAVVGTYLDASLPRDVSEGYPEHHQSIPPSPTPAQVRLHKTP
GRPEGSDSVSRHPSSSPPPGFHTGVLGASGTVAPPTDSSICYSFEWGRQINILPPTHNNRRPPLPTGLLHHLYTG
RNGRPLFHPLARFSFHHLRVLLFLLSLFHAVFLFLLLLARDAQSATRPAPLLRTLPFPPPPPPPSCSCSPRSDRL
IVVLSSSGSPERLAAMPGLFSRLKGRDGVKSKKRGAANDSTASQPQRQKWDDAYARKTVEPEEVHDLLHYCTVEL
KARGLDIPFLLLPFRPTSNPSAVRTFVRHFFDQNYSLRGELLLQELRMTEPMVISGVAKWCWSRLQGGIVGWDAY
ELFKVGEYDSNKARDSFKTFIPISVENGAKQRIIFDFFDLIAAIAAHGKSNGFGGRKLSRMAAWWAFEQRDTGSG
FDGGYTAWLSAADATSHLFFAYLRSLSPEQNLTGISMLPRSLEKLLKETDYPPPTPTQLMSSTNKLAMVVDAVSP
TPFALLRRAGHFEYRESDEGLLEFSNYEDPVKALTEECFRVLKAISAANQSQVSSVKHSTSLRDASWSRFEDIGF
ASPLDDDDGDDDATAATRLQGIRSTPASGAYQGRPTTPSWADFLSSGFNDENSARSNMLLPPDKAIPPLESQMRQ
QQSSQSHRPRLEQEGNLEPGELASIHVINLDDAFWWVWMSSLSPEETPERKSAFGRCAVIETKISAARWIIVEEL
IIGAAPEPQAGAYIAEKKRFFSWTKRSRTITRHKSMMKKNQDRGDANAQKAEAGKPIDAETQARIQAKAAQLRAV
QDHEQKAAEEAASLHRRGRTDAELIAERTNSVFTLQPNIVGEASSAMKWVNKYDKGAIKDAYLANSSAGRGTAVS
PAPSDHTKTRPPSHNGGKSSLEHAPVRESQSTSVVSPGSLPPSVPSQPQGLESEEARVSSSVKASTLTPSLRESV
EQASGAVAQSDPPTAAAPKKSSSERSKLHRNPAAREKSSGFRKLFSRKNRSSKLPENAATKLDGMLNKSQPAVAP
EVPQTPTPAATPPPAQESVAPVPPRKPVTPTEDAPSLPDGAPETPKSLEHPVEEPEPEEPEELVTTEVLSHIDTQ
DAAEASQEFSHFDQGPLTDQPAFEPEDEVGAEDTDDATPPPITRHPPRAGTPKAVEPEKAALDKLNQGASPGVQD
RWAQIRKNAAQRAATRKDEPSRAAVRKSTDGEEDTSGEETIESRVARIKARVAELTGGAGTSNGSQPTVKAR
Coding >Ophio5|2255
ATGTGCCAAAGGACCGGTTCGGCCTTGGAGGTAGTAGTCTCCTACCACGGCCCCGACTCTAAGCCAGACGCCGTC
TCTGCCGGGCTCTACCTGGTAGTGCATGCGGTGGTAGGTACATACCTCGACGCCTCTCTCCCACGCGACGTGTCT
GAGGGATATCCGGAGCACCATCAATCCATCCCCCCCTCCCCCACGCCGGCGCAGGTACGGCTGCACAAGACCCCC
GGAAGGCCGGAAGGCTCTGATTCTGTCTCTCGCCATCCCAGCTCCTCACCTCCTCCAGGCTTCCATACTGGTGTA
CTGGGTGCCAGCGGCACTGTAGCACCGCCGACCGACTCGAGTATCTGCTACTCCTTCGAATGGGGCCGCCAAATT
AACATTCTTCCACCAACCCACAATAACCGCCGCCCCCCTCTTCCAACCGGTCTCCTCCACCACTTATACACCGGT
CGAAACGGCCGGCCATTGTTTCACCCGCTCGCTCGCTTTTCTTTCCACCATCTGCGAGTCTTGCTTTTTTTGCTT
TCCCTCTTTCACGCTGTTTTCCTTTTTCTTCTCCTTCTGGCTCGAGACGCTCAATCTGCCACCCGTCCAGCCCCC
CTTTTGCGAACCCTTCCTTTCCCCCCCCCCCCCCCCCCCCCCTCCTGTTCCTGCTCCCCTAGGTCCGATCGTCTT
ATCGTCGTCCTCTCTTCCTCTGGCTCGCCAGAACGTCTCGCCGCCATGCCGGGCCTCTTCTCCCGCCTCAAGGGC
CGGGATGGCGTCAAGTCCAAGAAAAGGGGCGCTGCCAACGACTCGACCGCCTCCCAGCCCCAGAGGCAGAAGTGG
GACGATGCCTACGCGCGCAAGACGGTCGAACCTGAGGAGGTCCACGATCTTCTGCATTATTGCACCGTCGAGCTC
AAGGCCAGAGGTCTCGACATTCCCTTCCTGCTTCTGCCCTTCCGACCCACGTCCAACCCGAGCGCCGTACGGACC
TTTGTCAGGCATTTCTTCGACCAAAATTACTCCTTGAGAGGCGAACTTCTGCTTCAGGAGCTTCGCATGACGGAG
CCCATGGTCATATCCGGAGTTGCGAAATGGTGTTGGAGCCGTCTTCAGGGTGGCATCGTCGGCTGGGACGCTTAC
GAGCTCTTCAAGGTTGGAGAATACGATTCGAACAAGGCCCGCGATTCCTTCAAGACCTTCATCCCCATCAGCGTA
GAGAATGGGGCCAAGCAGCGCATCATCTTCGACTTCTTCGACTTGATTGCAGCCATAGCCGCCCATGGCAAGTCC
AATGGCTTCGGCGGCCGGAAGCTGTCCCGCATGGCTGCCTGGTGGGCGTTTGAGCAGAGAGACACGGGCAGTGGC
TTCGACGGGGGCTACACGGCTTGGCTGAGCGCCGCCGATGCCACCAGTCACTTGTTCTTCGCCTACCTGAGGTCC
CTGTCACCAGAGCAGAACCTGACAGGCATTTCCATGCTCCCCAGGTCCCTCGAGAAGCTGCTCAAGGAGACGGAC
TACCCGCCGCCGACGCCCACGCAGCTCATGTCGAGCACCAACAAGCTGGCCATGGTGGTCGACGCCGTTTCTCCT
ACCCCCTTTGCTCTCTTGCGGCGAGCCGGCCACTTCGAGTATCGCGAATCGGACGAGGGCCTCCTGGAGTTCTCA
AACTACGAGGATCCTGTCAAAGCCCTGACCGAAGAGTGTTTCCGTGTGCTCAAGGCCATCTCGGCAGCGAACCAG
TCCCAGGTCTCGAGCGTCAAGCACTCTACGAGTCTGCGTGACGCCTCGTGGTCTCGCTTCGAGGACATTGGCTTC
GCGAGCCCTCTCGACGACGACGATGGCGACGACGACGCCACGGCTGCCACTAGGCTGCAGGGCATTCGGAGCACC
CCCGCGTCTGGCGCCTACCAGGGTCGGCCAACGACGCCATCGTGGGCCGACTTCCTATCGTCCGGGTTCAACGAC
GAAAATTCGGCCAGGTCAAACATGCTCTTGCCCCCGGACAAGGCCATACCGCCCCTTGAGAGCCAGATGAGACAA
CAGCAGAGCTCGCAGTCCCACCGCCCGCGGCTGGAGCAGGAAGGCAACCTCGAGCCTGGTGAACTGGCCAGCATA
CACGTCATCAACCTGGACGACGCCTTTTGGTGGGTCTGGATGAGCAGCCTCTCACCCGAGGAGACTCCGGAGAGG
AAGTCGGCGTTTGGCAGGTGTGCCGTCATCGAGACCAAGATCAGCGCCGCCCGATGGATCATCGTGGAAGAGCTG
ATTATTGGTGCTGCTCCTGAACCTCAGGCGGGCGCCTACATCGCCGAGAAGAAGCGCTTCTTCAGCTGGACCAAG
CGCAGCCGCACCATTACGCGACACAAGTCCATGATGAAGAAGAATCAGGACCGAGGCGATGCAAACGCGCAAAAG
GCCGAGGCCGGGAAGCCCATCGACGCCGAGACGCAGGCCAGGATTCAGGCCAAGGCCGCCCAATTGCGTGCCGTC
CAGGACCACGAGCAAAAGGCTGCCGAAGAGGCGGCGAGCCTTCACCGCCGCGGCCGTACCGACGCGGAGCTGATA
GCCGAGAGGACTAACAGTGTTTTCACCCTTCAGCCAAACATCGTCGGTGAGGCCTCGTCGGCTATGAAATGGGTC
AACAAGTACGACAAGGGCGCTATTAAGGATGCGTACCTGGCCAACAGCAGCGCTGGCCGTGGCACGGCCGTGTCT
CCTGCGCCTTCGGACCACACCAAAACGCGACCTCCCAGCCACAACGGCGGCAAGTCGAGCTTGGAGCACGCGCCC
GTCAGGGAGTCGCAATCAACCTCGGTCGTGTCGCCTGGGTCGCTGCCACCCTCTGTCCCTTCTCAGCCACAGGGG
CTGGAGTCGGAGGAGGCGCGCGTGTCCTCGTCGGTGAAAGCTTCGACGCTGACTCCCTCGCTGCGAGAGAGCGTA
GAGCAGGCCTCCGGAGCCGTGGCTCAGTCCGACCCTCCGACTGCTGCCGCGCCGAAAAAATCTAGTTCCGAACGG
TCCAAGCTTCACCGGAACCCCGCTGCCAGGGAGAAGTCGAGTGGCTTCCGCAAGCTGTTCAGCCGGAAGAACCGC
TCGTCCAAACTGCCCGAGAACGCTGCCACCAAATTGGACGGAATGCTCAACAAGTCGCAGCCTGCCGTGGCGCCC
GAGGTGCCACAGACTCCGACCCCGGCCGCTACTCCACCCCCTGCTCAGGAGAGCGTTGCTCCCGTGCCGCCTCGG
AAACCCGTGACTCCGACTGAAGATGCGCCGAGTCTTCCTGATGGGGCGCCGGAAACACCCAAGTCTCTGGAGCAT
CCGGTCGAGGAGCCGGAACCCGAGGAGCCGGAGGAACTGGTGACGACCGAGGTGCTGTCACACATCGACACGCAA
GACGCCGCCGAGGCGAGCCAGGAGTTTTCACACTTCGACCAAGGACCGCTGACGGATCAGCCAGCCTTTGAGCCC
GAGGACGAGGTGGGGGCTGAGGATACCGACGACGCCACTCCGCCGCCCATCACCCGCCATCCCCCTCGCGCGGGA
ACGCCCAAGGCGGTGGAGCCTGAAAAGGCGGCTCTGGATAAGCTCAATCAAGGTGCTAGCCCTGGCGTGCAGGAT
CGCTGGGCTCAGATCCGCAAGAATGCTGCGCAAAGGGCCGCGACCCGCAAAGATGAACCGTCGCGAGCCGCGGTC
CGCAAATCGACGGACGGCGAGGAAGACACCAGCGGAGAGGAGACCATCGAGTCCCGCGTGGCTCGCATCAAGGCT
CGCGTGGCGGAGCTGACGGGAGGCGCCGGCACCAGCAACGGATCCCAACCGACCGTGAAGGCGCGC
Transcript >Ophio5|2255
ATGTGCCAAAGGACCGGTTCGGCCTTGGAGGTAGTAGTCTCCTACCACGGCCCCGACTCTAAGCCAGACGCCGTC
TCTGCCGGGCTCTACCTGGTAGTGCATGCGGTGGTAGGTACATACCTCGACGCCTCTCTCCCACGCGACGTGTCT
GAGGGATATCCGGAGCACCATCAATCCATCCCCCCCTCCCCCACGCCGGCGCAGGTACGGCTGCACAAGACCCCC
GGAAGGCCGGAAGGCTCTGATTCTGTCTCTCGCCATCCCAGCTCCTCACCTCCTCCAGGCTTCCATACTGGTGTA
CTGGGTGCCAGCGGCACTGTAGCACCGCCGACCGACTCGAGTATCTGCTACTCCTTCGAATGGGGCCGCCAAATT
AACATTCTTCCACCAACCCACAATAACCGCCGCCCCCCTCTTCCAACCGGTCTCCTCCACCACTTATACACCGGT
CGAAACGGCCGGCCATTGTTTCACCCGCTCGCTCGCTTTTCTTTCCACCATCTGCGAGTCTTGCTTTTTTTGCTT
TCCCTCTTTCACGCTGTTTTCCTTTTTCTTCTCCTTCTGGCTCGAGACGCTCAATCTGCCACCCGTCCAGCCCCC
CTTTTGCGAACCCTTCCTTTCCCCCCCCCCCCCCCCCCCCCCTCCTGTTCCTGCTCCCCTAGGTCCGATCGTCTT
ATCGTCGTCCTCTCTTCCTCTGGCTCGCCAGAACGTCTCGCCGCCATGCCGGGCCTCTTCTCCCGCCTCAAGGGC
CGGGATGGCGTCAAGTCCAAGAAAAGGGGCGCTGCCAACGACTCGACCGCCTCCCAGCCCCAGAGGCAGAAGTGG
GACGATGCCTACGCGCGCAAGACGGTCGAACCTGAGGAGGTCCACGATCTTCTGCATTATTGCACCGTCGAGCTC
AAGGCCAGAGGTCTCGACATTCCCTTCCTGCTTCTGCCCTTCCGACCCACGTCCAACCCGAGCGCCGTACGGACC
TTTGTCAGGCATTTCTTCGACCAAAATTACTCCTTGAGAGGCGAACTTCTGCTTCAGGAGCTTCGCATGACGGAG
CCCATGGTCATATCCGGAGTTGCGAAATGGTGTTGGAGCCGTCTTCAGGGTGGCATCGTCGGCTGGGACGCTTAC
GAGCTCTTCAAGGTTGGAGAATACGATTCGAACAAGGCCCGCGATTCCTTCAAGACCTTCATCCCCATCAGCGTA
GAGAATGGGGCCAAGCAGCGCATCATCTTCGACTTCTTCGACTTGATTGCAGCCATAGCCGCCCATGGCAAGTCC
AATGGCTTCGGCGGCCGGAAGCTGTCCCGCATGGCTGCCTGGTGGGCGTTTGAGCAGAGAGACACGGGCAGTGGC
TTCGACGGGGGCTACACGGCTTGGCTGAGCGCCGCCGATGCCACCAGTCACTTGTTCTTCGCCTACCTGAGGTCC
CTGTCACCAGAGCAGAACCTGACAGGCATTTCCATGCTCCCCAGGTCCCTCGAGAAGCTGCTCAAGGAGACGGAC
TACCCGCCGCCGACGCCCACGCAGCTCATGTCGAGCACCAACAAGCTGGCCATGGTGGTCGACGCCGTTTCTCCT
ACCCCCTTTGCTCTCTTGCGGCGAGCCGGCCACTTCGAGTATCGCGAATCGGACGAGGGCCTCCTGGAGTTCTCA
AACTACGAGGATCCTGTCAAAGCCCTGACCGAAGAGTGTTTCCGTGTGCTCAAGGCCATCTCGGCAGCGAACCAG
TCCCAGGTCTCGAGCGTCAAGCACTCTACGAGTCTGCGTGACGCCTCGTGGTCTCGCTTCGAGGACATTGGCTTC
GCGAGCCCTCTCGACGACGACGATGGCGACGACGACGCCACGGCTGCCACTAGGCTGCAGGGCATTCGGAGCACC
CCCGCGTCTGGCGCCTACCAGGGTCGGCCAACGACGCCATCGTGGGCCGACTTCCTATCGTCCGGGTTCAACGAC
GAAAATTCGGCCAGGTCAAACATGCTCTTGCCCCCGGACAAGGCCATACCGCCCCTTGAGAGCCAGATGAGACAA
CAGCAGAGCTCGCAGTCCCACCGCCCGCGGCTGGAGCAGGAAGGCAACCTCGAGCCTGGTGAACTGGCCAGCATA
CACGTCATCAACCTGGACGACGCCTTTTGGTGGGTCTGGATGAGCAGCCTCTCACCCGAGGAGACTCCGGAGAGG
AAGTCGGCGTTTGGCAGGTGTGCCGTCATCGAGACCAAGATCAGCGCCGCCCGATGGATCATCGTGGAAGAGCTG
ATTATTGGTGCTGCTCCTGAACCTCAGGCGGGCGCCTACATCGCCGAGAAGAAGCGCTTCTTCAGCTGGACCAAG
CGCAGCCGCACCATTACGCGACACAAGTCCATGATGAAGAAGAATCAGGACCGAGGCGATGCAAACGCGCAAAAG
GCCGAGGCCGGGAAGCCCATCGACGCCGAGACGCAGGCCAGGATTCAGGCCAAGGCCGCCCAATTGCGTGCCGTC
CAGGACCACGAGCAAAAGGCTGCCGAAGAGGCGGCGAGCCTTCACCGCCGCGGCCGTACCGACGCGGAGCTGATA
GCCGAGAGGACTAACAGTGTTTTCACCCTTCAGCCAAACATCGTCGGTGAGGCCTCGTCGGCTATGAAATGGGTC
AACAAGTACGACAAGGGCGCTATTAAGGATGCGTACCTGGCCAACAGCAGCGCTGGCCGTGGCACGGCCGTGTCT
CCTGCGCCTTCGGACCACACCAAAACGCGACCTCCCAGCCACAACGGCGGCAAGTCGAGCTTGGAGCACGCGCCC
GTCAGGGAGTCGCAATCAACCTCGGTCGTGTCGCCTGGGTCGCTGCCACCCTCTGTCCCTTCTCAGCCACAGGGG
CTGGAGTCGGAGGAGGCGCGCGTGTCCTCGTCGGTGAAAGCTTCGACGCTGACTCCCTCGCTGCGAGAGAGCGTA
GAGCAGGCCTCCGGAGCCGTGGCTCAGTCCGACCCTCCGACTGCTGCCGCGCCGAAAAAATCTAGTTCCGAACGG
TCCAAGCTTCACCGGAACCCCGCTGCCAGGGAGAAGTCGAGTGGCTTCCGCAAGCTGTTCAGCCGGAAGAACCGC
TCGTCCAAACTGCCCGAGAACGCTGCCACCAAATTGGACGGAATGCTCAACAAGTCGCAGCCTGCCGTGGCGCCC
GAGGTGCCACAGACTCCGACCCCGGCCGCTACTCCACCCCCTGCTCAGGAGAGCGTTGCTCCCGTGCCGCCTCGG
AAACCCGTGACTCCGACTGAAGATGCGCCGAGTCTTCCTGATGGGGCGCCGGAAACACCCAAGTCTCTGGAGCAT
CCGGTCGAGGAGCCGGAACCCGAGGAGCCGGAGGAACTGGTGACGACCGAGGTGCTGTCACACATCGACACGCAA
GACGCCGCCGAGGCGAGCCAGGAGTTTTCACACTTCGACCAAGGACCGCTGACGGATCAGCCAGCCTTTGAGCCC
GAGGACGAGGTGGGGGCTGAGGATACCGACGACGCCACTCCGCCGCCCATCACCCGCCATCCCCCTCGCGCGGGA
ACGCCCAAGGCGGTGGAGCCTGAAAAGGCGGCTCTGGATAAGCTCAATCAAGGTGCTAGCCCTGGCGTGCAGGAT
CGCTGGGCTCAGATCCGCAAGAATGCTGCGCAAAGGGCCGCGACCCGCAAAGATGAACCGTCGCGAGCCGCGGTC
CGCAAATCGACGGACGGCGAGGAAGACACCAGCGGAGAGGAGACCATCGAGTCCCGCGTGGCTCGCATCAAGGCT
CGCGTGGCGGAGCTGACGGGAGGCGCCGGCACCAGCAACGGATCCCAACCGACCGTGAAGGCGCGCTAG
Gene >Ophio5|2255
ATGTGCCAAAGTAGGCGGGTACCCCTGGGCCGTGCAGATTGAGCTTCTGAACTGTAGTACTGCTAGGTGAATCTC
GTTAACACCTTCACAGGGACCGGTTCGGCCTTGGTCAGAAGCCTTCATCATCAAATCATCAACCATTATCGTCTA
CTAGGTACTGCTACTGTCAAACTAGGAGGTAGTAGTCTCCTACCACGGCCCCGACTCTAAGCCAGACGCCGTCTC
TGCCGGGCTCTACCTGGTAGTGCATGCGGTGGTAGGTACATACCTCGACGCCTCTCTCCCACGCGACGTGTCTGA
GGGATATCCGGAGCACCATCAATCCATCCCCCCCTCCCCCACGCCGGCGCAGGTACGGCTGCACAAGACCCCCGG
AAGGCCGGAAGGCTCTGATTCTGTCTCTCGCCATCCCAGCTCCTCACCTCCTCCAGGCTTCCATACTGGTGTACT
GGGTGCCAGCGGCACTGTAGCACCGCGTCCGGCGCCGTCCTGACAGCTCCTCGCAGGGGCCTCGCAGCCAGACGG
CATCTTGTATCTGGTACCGCCACTTCTTAATCTGCTTAGCGACCGACTCGAGTATCTGCTACTCCTTCGAATGGG
GCCGCCAAATTAACAGTCCGTCATCCATCTCATTACTCTAGTGCACTGGGGAAGGGCCCGATGCCCCTTGCCGTG
CATCTTCGCGTCTCGCCCCCTGAGCAGCAGCCAGCAAAGCTCTCCTCCTCTGTCTCTCTCATTTTCCTCTCGCTC
TCTCTCTCTATCTCTGTCTCTCTTCCTTTTCTGCCGCTCCCTCCGTCCCTTCTGCGGTGGTTTTGTTCTTCTCGT
TTACCTCCACTGCTTTCGCCTCTTCCTTTCCCCCTTCGCCTATTTTTCTTTCATCCTTTCCCCTTACGTAGCCGG
CTCTGCATCGTCCCGACTCGAACTCTACAGTGCCTGACTCTTCTAGTTCTTCCACCAACCCACAATAACCGCCGC
CCCCCTCTTCCAACCGGTCTCCTCCACCACTTATACACCGGTCGAAACGGCCGGCCATTGTTTCACCCGCTCGCT
CGCTTTTCTTTCCACCATCTGCGAGTCTTGCTTTTTTTGCTTTCCCTCTTTCACGCTGTTTTCCTTTTTCTTCTC
CTTCTGGCTCGAGACGCTCAATCTGCCACCCGTCCAGCCCCCCTTTTGCGAACCCTTCCTTTCCCCCCCCCCCCC
CCCCCCCCCTCCTGTTCCTGCTCCCCTAGGTCCGATCGTCTTATCGTCGTCCTCTCTTCCTCTGGCTCGCCAGAA
CGTCTCGCCGCCATGCCGGGCCTCTTCTCCCGCCTCAAGGGCCGGGATGGCGTCAAGTCCAAGAAAAGGGGCGCT
GCCAACGACTCGACCGCCTCCCAGCCCCAGAGGCAGAAGTGGGACGATGCCTACGCGCGCAAGACGGTCGAACCT
GAGGAGGTCCACGATCTTCTGCATTATTGCACCGTCGAGCTCAAGGCCAGAGGTATGCTCATGTGTGCCCTCGTA
CCATCCACTACCCTCTCTGACCGGCCTTTTTCCCTCTGCAGGTCTCGACATTCCCTTCCTGCTTCTGCCCTTCCG
ACCCACGTCCAACCCGAGCGCCGTACGGACCTTTGTCAGGCATTTCTTCGACCAAAATTACTCCTTGAGAGGCGA
ACTTCTGCTTCAGGAGCTTCGCATGACGGAGCCCATGGTAGGACCGCGCTCCGCCCTCTCGCCAAGGTCTCCCCG
ATGCTGATGTACCTCGCATCAGGTCATATCCGGAGTTGCGAAATGGTGTTGGAGCCGTCTTCAGGGTGGCATCGT
CGGCTGGGACGCTTACGAGCTCTTCAAGGTTGGAGAATACGGTACGTCGTGTCGAGGCCGTCCCGTGATAGTGCA
TTGCGCTCATTGTGCGCCAAGATTCGAACAAGGCCCGCGATTCCTTCAAGACCTTCATCCCCATCAGCGTAGAGA
ATGGGGCCAAGCAGCGCATCATCTTCGACTTCTTCGACTTGATTGCAGCCATAGCCGCCCATGGCAAGTCCAATG
GCTTCGGCGGCCGGAAGCTGTCCCGCATGGCTGCCTGGTGGGCGTTTGAGCAGAGAGACACGGGCAGTGGCTTCG
ACGGGGGCTACACGGCTTGGCTGAGGTTAGTTCTCTGCCGAACCGTTGAGATGAGACGCCGCGGAAGCTGACCAG
GAGACATGCAGCGCCGCCGATGCCACCAGTCACTTGTTCTTCGCCTACCTGAGGTCCCTGTCACCAGAGCAGAAC
CTGACAGGCATTTCCATGCTCCCCAGGTCCCTCGAGAAGCTGCTCAAGGAGACGGACTACCCGCCGCCGACGCCC
ACGCAGCTCATGTCGAGCACCAACAAGCTGGCCATGGTGGTCGACGCCGTTTCTCCTACCCCCTTTGCTCTCTTG
CGGCGAGCCGGCCACTTCGAGTATCGCGAATCGGACGAGGGCCTCCTGGAGTTCTCAAACTACGAGGATCCTGTC
AAAGCCCTGACCGAAGAGTGTTTCCGTGTGCTCAAGGCCATCTCGGCAGCGAACCAGTCCCAGGTCTCGAGCGTC
AAGCACTCTACGAGTCTGCGTGACGCCTCGTGGTCTCGCTTCGAGGACATTGGCTTCGCGAGCCCTCTCGACGAC
GACGATGGCGACGACGACGCCACGGCTGCCACTAGGCTGCAGGGCATTCGGAGCACCCCCGCGTCTGGCGCCTAC
CAGGGTCGGCCAACGACGCCATCGTGGGCCGACTTCCTATCGTCCGGGTTCAACGACGAAAATTCGGCCAGGTCA
AACATGCTCTTGCCCCCGGACAAGGCCATACCGCCCCTTGAGAGCCAGATGAGACAACAGCAGAGCTCGCAGTCC
CACCGCCCGCGGCTGGAGCAGGAAGGCAACCTCGAGCCTGGTGAACTGGCCAGCATACACGTCATCAACCTGGAC
GACGCCTTTTGGTGGGTCTGGATGAGCAGCCTCTCACCCGAGGAGACTCCGGAGAGGAAGTCGGCGTTTGGCAGG
TGTGCCGTCATCGAGACCAAGATCAGCGCCGCCCGATGGATCATCGTGGAAGAGCTGATTATTGGTGCTGCTCCT
GAACCTCAGGCGGGCGCCTACATCGCCGAGAAGAAGCGCTTCTTCAGCTGGACCAAGCGCAGCCGCACCATTACG
CGACACAAGTCCATGATGAAGAAGAATCAGGACCGAGGCGATGCAAACGCGCAAAAGGCCGAGGCCGGGAAGCCC
ATCGACGCCGAGACGCAGGCCAGGATTCAGGCCAAGGCCGCCCAATTGCGTGCCGTCCAGGACCACGAGCAAAAG
GCTGCCGAAGAGGCGGCGAGCCTTCACCGCCGCGGCCGTACCGACGCGGAGCTGATAGCCGAGAGGACTAACAGT
GTTTTCACCCTTCAGCCAAACATCGTCGGTGAGGCCTCGTCGGCTATGAAATGGGTCAACAAGTACGACAAGGGC
GCTATTAAGGATGCGTACCTGGCCAACAGCAGCGCTGGCCGTGGCACGGCCGTGTCTCCTGCGCCTTCGGACCAC
ACCAAAACGCGACCTCCCAGCCACAACGGCGGCAAGTCGAGCTTGGAGCACGCGCCCGTCAGGGAGTCGCAATCA
ACCTCGGTCGTGTCGCCTGGGTCGCTGCCACCCTCTGTCCCTTCTCAGCCACAGGGGCTGGAGTCGGAGGAGGCG
CGCGTGTCCTCGTCGGTGAAAGCTTCGACGCTGACTCCCTCGCTGCGAGAGAGCGTAGAGCAGGCCTCCGGAGCC
GTGGCTCAGTCCGACCCTCCGACTGCTGCCGCGCCGAAAAAATCTAGTTCCGAACGGTCCAAGCTTCACCGGAAC
CCCGCTGCCAGGGAGAAGTCGAGTGGCTTCCGCAAGCTGTTCAGCCGGAAGAACCGCTCGTCCAAACTGCCCGAG
AACGCTGCCACCAAATTGGACGGAATGCTCAACAAGTCGCAGCCTGCCGTGGCGCCCGAGGTGCCACAGACTCCG
ACCCCGGCCGCTACTCCACCCCCTGCTCAGGAGAGCGTTGCTCCCGTGCCGCCTCGGAAACCCGTGACTCCGACT
GAAGATGCGCCGAGTCTTCCTGATGGGGCGCCGGAAACACCCAAGTCTCTGGAGCATCCGGTCGAGGAGCCGGAA
CCCGAGGAGCCGGAGGAACTGGTGACGACCGAGGTGCTGTCACACATCGACACGCAAGACGCCGCCGAGGCGAGC
CAGGAGTTTTCACACTTCGACCAAGGACCGCTGACGGATCAGCCAGCCTTTGAGCCCGAGGACGAGGTGGGGGCT
GAGGATACCGACGACGCCACTCCGCCGCCCATCACCCGCCATCCCCCTCGCGCGGGAACGCCCAAGGCGGTGGAG
CCTGAAAAGGCGGCTCTGGATAAGCTCAATCAAGGTGCTAGCCCTGGCGTGCAGGATCGCTGGGCTCAGATCCGC
AAGAATGCTGCGCAAAGGGCCGCGACCCGCAAAGATGAACCGTCGCGAGCCGCGGTCCGCAAATCGACGGACGGC
GAGGAAGACACCAGCGGAGAGGAGAGTACGTATCGCCCCCAGAACACCCATGTCACCGTGCCAGGCTTGCTGACC
CCCCCTTGTCCAGCCATCGAGTCCCGCGTGGCTCGCATCAAGGCTCGCGTGGCGGAGCTGACGGGAGGCGCCGGC
ACCAGCAACGGATCCCAACCGACCGTGAAGGCGCGCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail