Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|2254
Gene name
Locationscaffold_193:13124..15237
Strand+
Gene length (bp)2113
Transcript length (bp)1956
Coding sequence length (bp)1953
Protein length (aa) 651

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05277 DUF726 Protein of unknown function (DUF726) 3.3E-107 277 634

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9US10|YK68_SCHPO Uncharacterized membrane protein C6F6.13c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC607.08c PE=3 SV=1 174 635 6.0E-69
sp|Q91WU4|TMCO4_MOUSE Transmembrane and coiled-coil domain-containing protein 4 OS=Mus musculus GN=Tmco4 PE=2 SV=2 213 635 2.0E-56
sp|Q5TGY1|TMCO4_HUMAN Transmembrane and coiled-coil domain-containing protein 4 OS=Homo sapiens GN=TMCO4 PE=2 SV=1 213 635 2.0E-54
sp|Q499U8|TMCO4_RAT Transmembrane and coiled-coil domain-containing protein 4 OS=Rattus norvegicus GN=Tmco4 PE=2 SV=1 199 635 3.0E-53
sp|O14244|YELD_SCHPO Uncharacterized membrane protein C6F6.13c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC6F6.13c PE=3 SV=1 195 629 2.0E-48
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9US10|YK68_SCHPO Uncharacterized membrane protein C6F6.13c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC607.08c PE=3 SV=1 174 635 6.0E-69
sp|Q91WU4|TMCO4_MOUSE Transmembrane and coiled-coil domain-containing protein 4 OS=Mus musculus GN=Tmco4 PE=2 SV=2 213 635 2.0E-56
sp|Q5TGY1|TMCO4_HUMAN Transmembrane and coiled-coil domain-containing protein 4 OS=Homo sapiens GN=TMCO4 PE=2 SV=1 213 635 2.0E-54
sp|Q499U8|TMCO4_RAT Transmembrane and coiled-coil domain-containing protein 4 OS=Rattus norvegicus GN=Tmco4 PE=2 SV=1 199 635 3.0E-53
sp|O14244|YELD_SCHPO Uncharacterized membrane protein C6F6.13c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC6F6.13c PE=3 SV=1 195 629 2.0E-48
sp|Q20035|TMCO4_CAEEL Uncharacterized membrane protein F35D11.3 OS=Caenorhabditis elegans GN=F35D11.3 PE=3 SV=2 205 634 4.0E-45
sp|P43564|YFD4_YEAST Uncharacterized membrane protein YFL034W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YFL034W PE=1 SV=2 204 635 2.0E-40
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 15 0.45

Transmembrane Domains

Domain # Start End Length
1 285 307 22
2 322 344 22
3 461 483 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
SC16a Pure fungal culture 36.81 20.04 53.58
CcL In ants, during behavior modification 24.31 12.49 36.12
CcD In ants, recently dead 17.74 8.58 26.89

Differential expression

Label1 Label2 Q-value Significant difference
SC16a CcL 0.075303 no
SC16a CcD 0.001217 yes
CcL CcD 0.211863 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|2254
MAPLCADPRQVVIALDVTQRLSLLQLVQDITSYMISQLEAPTDQLGPVSPGEENDGVGGGTGPSLDAQQQKLTSI
EKPTQEASTGKVAQETSSDKPPQEAATNNPPHKPSIGRAAQDAKSIQLAAMDNLRQWRDEFLPRLRDIAEVKDSS
AIEAERQARREKLKKEDAETTESSSPEDVTQLQSLYRPMPTPLTELPPQDRREALTCTLLLLLATGKYSAHSRAL
MLYLASALALPPTFVNEQEGEIAKSLMESSNADGKENMSAEAEAAKRQEENKLSRYWKVGLASVAGAAVIGVTGG
LAAPLVAGAISGIMGGVGLGGVASFLGIFWANGALVGALFGAYGAKMTGEMMDNYAKEVEDFRFIPLDQDQQQTD
QPSEKTDKGQQQAKAEQRRLRVTIGINGWLSSESDIQKPWLVLGADSEAFALRYELKTLLGLGSALNDLVHSLAW
KTVKRELVKRTALATLLAALWPVQILAAASTSIDNPFQRARHRSRKAGRLLADALVNRVQGERPVALVGYSLGAS
AIHACLQELADRRAFGLVDSVVLIGAPAPAASDHWRALRPVVSGTIFNVYSENDLVLGLVYRLHALDYGVAGLQP
VHGVPALRNVDFSAHVTGHLRYPLLTADILRRCGFLPPQVVNTQQAGGESP
Coding >Ophio5|2254
ATGGCGCCCCTCTGCGCGGACCCGCGTCAAGTCGTCATCGCACTCGACGTTACTCAGCGCCTCTCGCTCCTCCAA
CTCGTCCAGGATATCACCTCGTACATGATATCCCAGCTCGAAGCGCCAACCGATCAGCTTGGCCCCGTCTCCCCA
GGAGAGGAAAATGATGGGGTCGGCGGCGGAACAGGGCCATCGCTTGACGCGCAGCAGCAAAAGCTGACGTCCATC
GAGAAGCCTACGCAAGAGGCGTCCACCGGCAAGGTCGCGCAAGAGACGTCATCCGACAAGCCTCCCCAAGAGGCG
GCCACCAACAACCCCCCTCATAAGCCGTCCATCGGTAGAGCTGCCCAAGATGCCAAGAGCATACAGCTAGCGGCC
ATGGATAATCTCAGGCAATGGAGAGACGAATTCCTCCCCCGACTGCGCGACATCGCCGAGGTCAAGGACAGCTCC
GCCATCGAAGCCGAGCGGCAGGCCAGGCGAGAGAAGCTGAAGAAAGAGGACGCAGAAACGACCGAGAGCAGCTCA
CCAGAAGACGTGACGCAGCTGCAGTCCCTCTACCGTCCCATGCCCACACCCCTGACCGAGCTCCCCCCGCAAGAC
AGACGCGAAGCTCTCACCTGCACCCTCCTGCTCCTCCTCGCAACGGGGAAATACTCGGCCCACTCGCGCGCCCTG
ATGCTATACCTTGCGTCCGCCCTGGCACTACCCCCCACCTTCGTCAACGAGCAAGAAGGCGAGATAGCCAAGTCG
CTTATGGAGTCTTCGAATGCAGACGGTAAGGAAAACATGTCCGCCGAGGCCGAAGCCGCCAAGCGTCAAGAGGAG
AACAAGCTCAGTCGGTACTGGAAAGTCGGCCTCGCGTCCGTGGCGGGAGCGGCCGTCATCGGCGTCACGGGCGGT
CTGGCGGCGCCGCTCGTGGCCGGCGCCATCAGCGGCATCATGGGCGGTGTCGGCCTGGGCGGAGTCGCTAGCTTT
CTCGGTATCTTCTGGGCGAATGGTGCGCTGGTCGGGGCCCTGTTTGGCGCGTACGGCGCAAAGATGACGGGCGAG
ATGATGGACAACTACGCAAAAGAAGTCGAAGACTTCCGCTTCATCCCCCTGGACCAAGACCAGCAGCAGACAGAC
CAGCCGTCAGAGAAGACAGACAAAGGCCAACAGCAAGCCAAGGCAGAGCAGCGCCGGCTCCGCGTCACCATCGGC
ATCAACGGCTGGCTCAGCTCGGAAAGCGACATCCAGAAACCCTGGCTCGTGCTCGGCGCCGACTCGGAAGCGTTC
GCTCTACGGTACGAGCTCAAGACTCTTCTCGGCCTCGGCTCGGCCCTCAACGACCTCGTCCACTCGCTCGCTTGG
AAGACGGTCAAGCGGGAACTCGTCAAGCGCACCGCCCTCGCCACCCTCCTCGCAGCATTGTGGCCCGTCCAGATC
CTGGCGGCGGCATCGACCTCCATCGACAACCCCTTTCAGCGCGCCCGTCACCGATCCCGCAAGGCGGGCCGTCTC
CTGGCCGACGCCCTCGTCAATAGAGTGCAGGGAGAGCGTCCGGTAGCCCTGGTGGGCTACTCGCTAGGCGCTTCC
GCCATACATGCATGTCTGCAGGAACTCGCCGACCGGCGCGCCTTCGGCCTCGTCGACTCCGTCGTCCTCATCGGG
GCGCCCGCCCCCGCCGCCTCGGACCATTGGCGCGCCTTGCGTCCCGTCGTGTCCGGTACCATCTTCAACGTCTAC
TCGGAGAATGACCTCGTCCTCGGCCTCGTCTATCGTTTGCATGCCCTCGATTATGGCGTCGCCGGCCTGCAGCCC
GTTCATGGTGTGCCCGCTCTTCGGAACGTAGACTTCTCCGCTCATGTTACAGGCCATTTGCGCTACCCGCTGCTG
ACGGCTGATATCCTTCGTCGCTGCGGCTTCCTCCCCCCCCAAGTTGTTAATACGCAGCAAGCAGGAGGCGAATCT
CCA
Transcript >Ophio5|2254
ATGGCGCCCCTCTGCGCGGACCCGCGTCAAGTCGTCATCGCACTCGACGTTACTCAGCGCCTCTCGCTCCTCCAA
CTCGTCCAGGATATCACCTCGTACATGATATCCCAGCTCGAAGCGCCAACCGATCAGCTTGGCCCCGTCTCCCCA
GGAGAGGAAAATGATGGGGTCGGCGGCGGAACAGGGCCATCGCTTGACGCGCAGCAGCAAAAGCTGACGTCCATC
GAGAAGCCTACGCAAGAGGCGTCCACCGGCAAGGTCGCGCAAGAGACGTCATCCGACAAGCCTCCCCAAGAGGCG
GCCACCAACAACCCCCCTCATAAGCCGTCCATCGGTAGAGCTGCCCAAGATGCCAAGAGCATACAGCTAGCGGCC
ATGGATAATCTCAGGCAATGGAGAGACGAATTCCTCCCCCGACTGCGCGACATCGCCGAGGTCAAGGACAGCTCC
GCCATCGAAGCCGAGCGGCAGGCCAGGCGAGAGAAGCTGAAGAAAGAGGACGCAGAAACGACCGAGAGCAGCTCA
CCAGAAGACGTGACGCAGCTGCAGTCCCTCTACCGTCCCATGCCCACACCCCTGACCGAGCTCCCCCCGCAAGAC
AGACGCGAAGCTCTCACCTGCACCCTCCTGCTCCTCCTCGCAACGGGGAAATACTCGGCCCACTCGCGCGCCCTG
ATGCTATACCTTGCGTCCGCCCTGGCACTACCCCCCACCTTCGTCAACGAGCAAGAAGGCGAGATAGCCAAGTCG
CTTATGGAGTCTTCGAATGCAGACGGTAAGGAAAACATGTCCGCCGAGGCCGAAGCCGCCAAGCGTCAAGAGGAG
AACAAGCTCAGTCGGTACTGGAAAGTCGGCCTCGCGTCCGTGGCGGGAGCGGCCGTCATCGGCGTCACGGGCGGT
CTGGCGGCGCCGCTCGTGGCCGGCGCCATCAGCGGCATCATGGGCGGTGTCGGCCTGGGCGGAGTCGCTAGCTTT
CTCGGTATCTTCTGGGCGAATGGTGCGCTGGTCGGGGCCCTGTTTGGCGCGTACGGCGCAAAGATGACGGGCGAG
ATGATGGACAACTACGCAAAAGAAGTCGAAGACTTCCGCTTCATCCCCCTGGACCAAGACCAGCAGCAGACAGAC
CAGCCGTCAGAGAAGACAGACAAAGGCCAACAGCAAGCCAAGGCAGAGCAGCGCCGGCTCCGCGTCACCATCGGC
ATCAACGGCTGGCTCAGCTCGGAAAGCGACATCCAGAAACCCTGGCTCGTGCTCGGCGCCGACTCGGAAGCGTTC
GCTCTACGGTACGAGCTCAAGACTCTTCTCGGCCTCGGCTCGGCCCTCAACGACCTCGTCCACTCGCTCGCTTGG
AAGACGGTCAAGCGGGAACTCGTCAAGCGCACCGCCCTCGCCACCCTCCTCGCAGCATTGTGGCCCGTCCAGATC
CTGGCGGCGGCATCGACCTCCATCGACAACCCCTTTCAGCGCGCCCGTCACCGATCCCGCAAGGCGGGCCGTCTC
CTGGCCGACGCCCTCGTCAATAGAGTGCAGGGAGAGCGTCCGGTAGCCCTGGTGGGCTACTCGCTAGGCGCTTCC
GCCATACATGCATGTCTGCAGGAACTCGCCGACCGGCGCGCCTTCGGCCTCGTCGACTCCGTCGTCCTCATCGGG
GCGCCCGCCCCCGCCGCCTCGGACCATTGGCGCGCCTTGCGTCCCGTCGTGTCCGGTACCATCTTCAACGTCTAC
TCGGAGAATGACCTCGTCCTCGGCCTCGTCTATCGTTTGCATGCCCTCGATTATGGCGTCGCCGGCCTGCAGCCC
GTTCATGGTGTGCCCGCTCTTCGGAACGTAGACTTCTCCGCTCATGTTACAGGCCATTTGCGCTACCCGCTGCTG
ACGGCTGATATCCTTCGTCGCTGCGGCTTCCTCCCCCCCCAAGTTGTTAATACGCAGCAAGCAGGAGGCGAATCT
CCATAG
Gene >Ophio5|2254
ATGGCGCCCCTCTGCGCGGACCCGCGTCAAGTCGTCATCGCACTCGACGTTACTCAGCGCCTCTCGCTCCTCCAA
CTCGTCCAGGATATCACCTCGTACATGATATCCCAGCTCGAAGCGCCAACCGATCAGCTTGGCCCCGTCTCCCCA
GGAGAGGAAAATGATGGGGTCGGCGGCGGAACAGGGCCATCGCTTGACGCGCAGCAGCAAAAGCTGACGTCCATC
GAGAAGCCTACGCAAGAGGCGTCCACCGGCAAGGTCGCGCAAGAGACGTCATCCGACAAGCCTCCCCAAGAGGCG
GCCACCAACAACCCCCCTCATAAGCCGTCCATCGGTAGAGCTGCCCAAGATGCCAAGAGCATACAGCTAGCGGCC
ATGGATAATCTCAGGCAATGGAGAGACGAATTCCTCCCCCGACTGCGCGACATCGCCGAGGTCAAGGACAGCTCC
GCCATCGAAGCCGAGCGGCAGGCCAGGCGAGAGAAGCTGAAGAAAGAGGACGCAGAAACGACCGAGAGCAGCTCA
CCAGAAGACGTGACGCAGCTGCAGTCCCTCTACCGTCCCATGCCCACACCCCTGACCGAGCTCCCCCCGCAAGAC
AGACGCGAAGCTCTCACCTGCACCCTCCTGCTCCTCCTCGCAACGGGGAAATACTCGGCCCACTCGCGCGCCCTG
ATGCTATACCTTGCGTCCGCCCTGGCACTACCCCCCACCTTCGTCAACGAGCAAGAAGGCGAGATAGCCAAGTCG
CTTATGGAGTCTTCGAATGCAGACGGTAAGGAAAACATGTCCGCCGAGGCCGAAGCCGCCAAGCGTCAAGAGGAG
AACAAGCTCAGTCGGTACTGGAAAGTCGGCCTCGCGTCCGTGGCGGGAGCGGCCGTCATCGGCGTCACGGGCGGT
CTGGCGGCGCCGCTCGTGGCCGGCGCCATCAGCGGCATCATGGGCGGTGTCGGCCTGGGCGGAGTCGCTAGCTTT
CTCGGTATCTTCTGGGCGAATGGTGCGCTGGTCGGGGCCCTGTTTGGCGCGTACGGCGCAAAGATGACGGTGAGA
ATCGGTTTCTTTCTTTTTTTTTTTCCTTCCCGGTAAGGGGGGGGGGTTCCGTGGACATGCCCAAGCTGAGAAGAA
TGTCCTCATGTCCCAGGGCGAGATGATGGACAACTACGCAAAAGAAGTCGAAGACTTCCGCTTCATCCCCCTGGA
CCAAGACCAGCAGCAGACAGACCAGCCGTCAGAGAAGACAGACAAAGGCCAACAGCAAGCCAAGGCAGAGCAGCG
CCGGCTCCGCGTCACCATCGGCATCAACGGCTGGCTCAGCTCGGAAAGCGACATCCAGAAACCCTGGCTCGTGCT
CGGCGCCGACTCGGAAGCGTTCGCTCTACGGTACGAGCTCAAGACTCTTCTCGGCCTCGGCTCGGCCCTCAACGA
CCTCGTCCACTCGCTCGCTTGGAAGACGGTCAAGCGGGAACTCGTCAAGCGCACCGCCCTCGCCACCCTCCTCGC
AGCATTGTGGCCCGTCCAGATCCTGGCGGCGGCATCGACCTCCATCGACAACCCCTTTCAGCGCGCCCGTCACCG
ATCCCGCAAGGCGGGCCGTCTCCTGGCCGACGCCCTCGTCAATAGAGTGCAGGGAGAGCGTCCGGTAGCCCTGGT
GGGCTACTCGCTAGGCGCTTCCGCCATACATGCATGTCTGCAGGAACTCGCCGACCGGCGCGCCTTCGGCCTCGT
CGACTCCGTCGTCCTCATCGGGGCGCCCGCCCCCGCCGCCTCGGACCATTGGCGCGCCTTGCGTCCCGTCGTGTC
CGGTACCATCTTCAACGTCTACTCGGAGAATGACCTCGTCCTCGGCCTCGTCTATCGTTTGCATGCCCTCGATTA
TGGCGTCGCCGGCCTGCAGCCCGTTCATGGTGTGCCCGCTCTTCGGAACGTAGACTTCTCCGCTCATGTTACAGG
CCATTTGCGCTACCCGCTGCTGACGGCTGATATCCTTCGTCGCTGCGGCTTCCTCGTACGTCCCGCTGACGCGCA
GGAGCAGCCTGATTCCGACACTGCGGCTGATGGCGAGCAGCCCCCCCAAGTTGTTAATACGCAGCAAGCAGGAGG
CGAATCTCCATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail