Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|225
Gene name
Locationscaffold_104:34868..37483
Strand-
Gene length (bp)2615
Transcript length (bp)2316
Coding sequence length (bp)2313
Protein length (aa) 771

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12678 zf-rbx1 RING-H2 zinc finger domain 2.1E-09 345 398
PF13639 zf-RING_2 Ring finger domain 5.2E-08 344 398
PF13445 zf-RING_UBOX RING-type zinc-finger 1.3E-05 346 395
PF00097 zf-C3HC4 Zinc finger, C3HC4 type (RING finger) 2.6E-05 346 397

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q5Z880|HRD1_ORYSJ ERAD-associated E3 ubiquitin-protein ligase HRD1 OS=Oryza sativa subsp. japonica GN=HRD1 PE=2 SV=1 1 456 3.0E-60
sp|Q95SP2|HRD1_DROME E3 ubiquitin-protein ligase HRD1 OS=Drosophila melanogaster GN=sip3 PE=1 SV=1 7 398 4.0E-53
sp|A8Y4B2|HRD1_CAEBR E3 ubiquitin-protein ligase hrd-1 OS=Caenorhabditis briggsae GN=sel-11 PE=3 SV=2 4 401 7.0E-48
sp|O74757|HRD1_SCHPO ERAD-associated E3 ubiquitin-protein ligase hrd1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=hrd1 PE=1 SV=1 1 446 4.0E-41
sp|Q9LW77|HRD1A_ARATH ERAD-associated E3 ubiquitin-protein ligase HRD1A OS=Arabidopsis thaliana GN=HRD1A PE=2 SV=1 252 446 2.0E-36
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q5Z880|HRD1_ORYSJ ERAD-associated E3 ubiquitin-protein ligase HRD1 OS=Oryza sativa subsp. japonica GN=HRD1 PE=2 SV=1 1 456 3.0E-60
sp|Q95SP2|HRD1_DROME E3 ubiquitin-protein ligase HRD1 OS=Drosophila melanogaster GN=sip3 PE=1 SV=1 7 398 4.0E-53
sp|A8Y4B2|HRD1_CAEBR E3 ubiquitin-protein ligase hrd-1 OS=Caenorhabditis briggsae GN=sel-11 PE=3 SV=2 4 401 7.0E-48
sp|O74757|HRD1_SCHPO ERAD-associated E3 ubiquitin-protein ligase hrd1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=hrd1 PE=1 SV=1 1 446 4.0E-41
sp|Q9LW77|HRD1A_ARATH ERAD-associated E3 ubiquitin-protein ligase HRD1A OS=Arabidopsis thaliana GN=HRD1A PE=2 SV=1 252 446 2.0E-36
sp|Q6NPT7|HRD1B_ARATH ERAD-associated E3 ubiquitin-protein ligase HRD1B OS=Arabidopsis thaliana GN=HRD1B PE=2 SV=1 262 443 4.0E-35
sp|Q6NRL6|SYVNA_XENLA E3 ubiquitin-protein ligase synoviolin A OS=Xenopus laevis GN=syvn1-a PE=2 SV=1 262 401 1.0E-27
sp|Q9LW77|HRD1A_ARATH ERAD-associated E3 ubiquitin-protein ligase HRD1A OS=Arabidopsis thaliana GN=HRD1A PE=2 SV=1 1 199 3.0E-27
sp|Q5XHH7|SYVNB_XENLA E3 ubiquitin-protein ligase synoviolin B OS=Xenopus laevis GN=syvn1-b PE=2 SV=1 262 401 4.0E-27
sp|Q803I8|SYVN1_DANRE E3 ubiquitin-protein ligase synoviolin OS=Danio rerio GN=syvn1 PE=2 SV=2 262 401 4.0E-27
sp|Q803I8|SYVN1_DANRE E3 ubiquitin-protein ligase synoviolin OS=Danio rerio GN=syvn1 PE=2 SV=2 1 195 5.0E-27
sp|Q9DBY1|SYVN1_MOUSE E3 ubiquitin-protein ligase synoviolin OS=Mus musculus GN=Syvn1 PE=1 SV=3 262 401 3.0E-26
sp|Q5XHH7|SYVNB_XENLA E3 ubiquitin-protein ligase synoviolin B OS=Xenopus laevis GN=syvn1-b PE=2 SV=1 7 195 6.0E-26
sp|Q6NRL6|SYVNA_XENLA E3 ubiquitin-protein ligase synoviolin A OS=Xenopus laevis GN=syvn1-a PE=2 SV=1 7 195 8.0E-26
sp|Q9DBY1|SYVN1_MOUSE E3 ubiquitin-protein ligase synoviolin OS=Mus musculus GN=Syvn1 PE=1 SV=3 1 195 1.0E-25
sp|Q86TM6|SYVN1_HUMAN E3 ubiquitin-protein ligase synoviolin OS=Homo sapiens GN=SYVN1 PE=1 SV=2 1 195 2.0E-25
sp|Q6NPT7|HRD1B_ARATH ERAD-associated E3 ubiquitin-protein ligase HRD1B OS=Arabidopsis thaliana GN=HRD1B PE=2 SV=1 1 193 4.0E-25
sp|Q86TM6|SYVN1_HUMAN E3 ubiquitin-protein ligase synoviolin OS=Homo sapiens GN=SYVN1 PE=1 SV=2 262 432 1.0E-23
sp|Q20798|HRD1_CAEEL E3 ubiquitin-protein ligase hrd-1 OS=Caenorhabditis elegans GN=sel-11 PE=3 SV=1 4 195 1.0E-23
sp|Q20798|HRD1_CAEEL E3 ubiquitin-protein ligase hrd-1 OS=Caenorhabditis elegans GN=sel-11 PE=3 SV=1 261 401 5.0E-23
sp|Q08109|HRD1_YEAST ERAD-associated E3 ubiquitin-protein ligase HRD1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HRD1 PE=1 SV=1 2 406 4.0E-20
sp|Q8VYC8|RIN2_ARATH E3 ubiquitin protein ligase RIN2 OS=Arabidopsis thaliana GN=RIN2 PE=1 SV=1 31 420 1.0E-19
sp|Q75CC8|HRD1_ASHGO ERAD-associated E3 ubiquitin-protein ligase HRD1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=HRD1 PE=3 SV=2 33 404 3.0E-19
sp|Q9UKV5|AMFR_HUMAN E3 ubiquitin-protein ligase AMFR OS=Homo sapiens GN=AMFR PE=1 SV=2 256 409 2.0E-12
sp|Q9R049|AMFR_MOUSE E3 ubiquitin-protein ligase AMFR OS=Mus musculus GN=Amfr PE=1 SV=2 256 409 4.0E-12
sp|Q8W4Q5|RIN3_ARATH E3 ubiquitin protein ligase RIN3 OS=Arabidopsis thaliana GN=RIN3 PE=1 SV=2 18 405 3.0E-11
sp|Q5SWK7|RN145_MOUSE RING finger protein 145 OS=Mus musculus GN=Rnf145 PE=2 SV=1 319 457 3.0E-08
sp|Q9Y7K6|YGI4_SCHPO Uncharacterized RING finger protein C2A9.04c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC2A9.04c PE=3 SV=1 323 412 1.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0046872 metal ion binding Yes
GO:0008270 zinc ion binding Yes
GO:0046914 transition metal ion binding No
GO:0005488 binding No
GO:0003674 molecular_function No
GO:0043169 cation binding No
GO:0043167 ion binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.5

Transmembrane Domains

Domain # Start End Length
1 5 23 18
2 38 60 22
3 99 121 22
4 136 158 22
5 281 303 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
SC16a Pure fungal culture 127.48 62.29 192.68
CcL In ants, during behavior modification 96.00 46.66 145.33
CcD In ants, recently dead 72.04 38.42 105.65

Differential expression

Label1 Label2 Q-value Significant difference
SC16a CcL 0.286931 no
SC16a CcD 0.015671 yes
CcL CcD 0.250912 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|225
MRLGWYAGVSTALAGGVVISAFLQRANFYSAMVYLAQSNFCLLALVNFSLLLYSSFIYGLTRLCFGTLRAVEVEQ
LTERAWFAITETCLAMTIFREEIGAWFLVMFTALVTGKVWGWIGDGRVEFLEQQPPQNPRLFHFRLSISLAMSFM
YDVLILRYSVRNVIQQARPNMMVMFLFEFAVLATCSWRTAARYLLVLAEQNIIRAQTRKRLLERRQEVREQREAL
LRQREQAAAAGENTPANDEPLPSEDDVDEMDIDVPGWSTKGEWVLWLDLLSDMIKLGIYVAFFFMLLMFYGLPIH
IMRDLFMTSRDFIKRLNALLRYRRAIQEMNRYPDASADDLAQENTCIICREEMRPWDPVENPGAIDRVRPKKLPC
GHILHLGCLKSWLERQQVCPTCRSPVTADRGRGRPPVGPPALRIQLWPPRPQGQQPPADDAQQGQGNDGPQQRAP
REGGPRIFNLGPIRLGFGTNGQQIRELAQQFGVPHIAGNQAAAAAAGAQAPDQSQTALGDNLQSIGNLLRQSEQM
LQRETQRLSVPWPAAHNLPMNLPFPPAQQLPVPAPGNQTHPLGLPILPGAPSRSGSPLMARLGTSGATAPIPAGS
ADLPEGLTLPPGWSVVPLQRLDGSPIPGPVAPQPQMPLHDGDAATSSRQTANGQPAPVPVPGGTPSHTGGDVVDP
EPPADDLPSTEARPTVEPAALVAPSPVMPRWGGPSQLFNNGPRLGLDEPEQQPGESSSAEVPRTEAGERVDTEEE
GESLSKGKTKVVAVEEAHEEE
Coding >Ophio5|225
ATGCGGCTCGGCTGGTACGCTGGGGTCTCCACGGCCCTCGCGGGAGGCGTCGTCATCTCTGCCTTTCTGCAGCGA
GCCAACTTTTACTCGGCCATGGTCTATCTGGCCCAGAGCAACTTTTGCTTGCTGGCCTTGGTAAACTTTTCACTC
CTTCTTTACAGCAGCTTTATCTACGGCTTGACGCGCTTGTGCTTCGGCACGCTTCGGGCCGTCGAGGTCGAGCAG
CTTACTGAGCGAGCTTGGTTCGCCATCACCGAGACGTGCCTCGCCATGACCATTTTCAGAGAGGAAATAGGGGCC
TGGTTCCTGGTCATGTTCACGGCGTTGGTGACGGGCAAGGTGTGGGGCTGGATCGGCGATGGCCGAGTCGAGTTC
CTGGAGCAGCAGCCGCCGCAAAACCCGCGGCTCTTTCACTTTCGCCTTAGCATCTCGCTCGCCATGAGCTTCATG
TACGACGTGCTGATACTGCGATATTCGGTCCGGAACGTTATCCAACAGGCACGCCCAAACATGATGGTCATGTTC
CTTTTCGAATTCGCAGTGCTGGCCACGTGTTCTTGGCGAACAGCGGCACGCTACTTGCTCGTTCTGGCGGAACAA
AACATCATCAGGGCCCAGACGCGGAAGAGGCTGCTTGAGAGAAGACAAGAGGTTAGGGAGCAGCGGGAGGCATTG
CTACGACAGCGGGAGCAAGCCGCAGCTGCGGGAGAGAACACACCCGCCAACGACGAGCCCCTGCCGAGCGAGGAC
GATGTCGACGAAATGGACATTGACGTGCCCGGCTGGTCTACCAAAGGGGAATGGGTGTTATGGCTTGATCTCCTG
AGTGATATGATTAAGCTGGGCATATACGTTGCCTTCTTCTTCATGCTCCTTATGTTCTACGGCTTGCCCATACAC
ATCATGAGAGATTTGTTTATGACGTCTCGAGACTTTATCAAGAGGCTCAACGCCTTGCTGCGCTACCGTCGAGCC
ATCCAGGAAATGAACCGGTATCCCGACGCGTCCGCTGACGACCTCGCGCAGGAGAACACGTGCATTATCTGTCGC
GAAGAGATGAGGCCTTGGGACCCTGTTGAAAATCCGGGCGCCATCGATCGAGTGCGGCCCAAGAAGTTGCCTTGC
GGCCACATCCTGCATCTTGGCTGTCTCAAGAGCTGGCTCGAGCGACAGCAGGTGTGCCCAACATGCAGGAGTCCA
GTCACGGCCGATCGAGGTCGCGGTCGGCCTCCAGTCGGACCCCCCGCCCTGAGGATACAGCTCTGGCCGCCGAGG
CCGCAGGGCCAGCAGCCGCCGGCAGACGACGCGCAGCAGGGCCAAGGAAATGACGGTCCGCAGCAACGGGCGCCG
AGAGAAGGGGGACCTCGTATATTCAATCTCGGGCCCATCCGGCTCGGCTTTGGCACCAACGGCCAGCAGATCCGT
GAGCTTGCGCAGCAGTTTGGTGTGCCGCACATTGCTGGCAACCAGGCGGCAGCTGCTGCGGCAGGGGCTCAGGCC
CCGGACCAGAGCCAGACGGCGTTGGGCGACAACCTCCAAAGCATTGGTAATCTCCTCCGGCAGTCGGAGCAGATG
CTGCAGAGAGAGACGCAGCGCCTCAGCGTCCCCTGGCCGGCGGCCCATAACCTTCCGATGAACTTGCCGTTCCCG
CCAGCCCAGCAGCTTCCGGTCCCGGCGCCGGGGAACCAGACTCACCCCCTGGGCCTACCGATCTTGCCCGGCGCA
CCGTCTCGGTCTGGCAGTCCGCTCATGGCTCGTCTCGGCACGTCGGGAGCCACGGCACCGATCCCGGCCGGCAGC
GCAGACCTTCCGGAGGGATTGACGCTCCCTCCCGGATGGTCGGTGGTACCTCTTCAGAGGCTTGACGGTTCCCCG
ATCCCAGGTCCAGTCGCGCCCCAACCTCAGATGCCTCTGCACGACGGCGATGCCGCGACGAGCTCGCGCCAAACG
GCGAACGGACAGCCAGCTCCGGTGCCCGTTCCAGGCGGGACACCCAGCCATACGGGAGGAGACGTCGTTGACCCA
GAACCTCCCGCCGACGACCTCCCTTCAACGGAAGCTCGGCCGACCGTTGAGCCGGCTGCCCTCGTGGCCCCCAGT
CCCGTGATGCCCCGCTGGGGCGGCCCATCGCAGCTGTTCAACAACGGGCCCCGCCTCGGCCTTGACGAGCCCGAG
CAACAGCCGGGCGAGTCGTCGAGCGCGGAAGTGCCGCGTACGGAAGCAGGCGAGCGTGTGGACACTGAGGAGGAG
GGAGAGTCCTTGTCCAAGGGTAAGACGAAGGTGGTCGCGGTCGAAGAAGCTCACGAAGAAGAA
Transcript >Ophio5|225
ATGCGGCTCGGCTGGTACGCTGGGGTCTCCACGGCCCTCGCGGGAGGCGTCGTCATCTCTGCCTTTCTGCAGCGA
GCCAACTTTTACTCGGCCATGGTCTATCTGGCCCAGAGCAACTTTTGCTTGCTGGCCTTGGTAAACTTTTCACTC
CTTCTTTACAGCAGCTTTATCTACGGCTTGACGCGCTTGTGCTTCGGCACGCTTCGGGCCGTCGAGGTCGAGCAG
CTTACTGAGCGAGCTTGGTTCGCCATCACCGAGACGTGCCTCGCCATGACCATTTTCAGAGAGGAAATAGGGGCC
TGGTTCCTGGTCATGTTCACGGCGTTGGTGACGGGCAAGGTGTGGGGCTGGATCGGCGATGGCCGAGTCGAGTTC
CTGGAGCAGCAGCCGCCGCAAAACCCGCGGCTCTTTCACTTTCGCCTTAGCATCTCGCTCGCCATGAGCTTCATG
TACGACGTGCTGATACTGCGATATTCGGTCCGGAACGTTATCCAACAGGCACGCCCAAACATGATGGTCATGTTC
CTTTTCGAATTCGCAGTGCTGGCCACGTGTTCTTGGCGAACAGCGGCACGCTACTTGCTCGTTCTGGCGGAACAA
AACATCATCAGGGCCCAGACGCGGAAGAGGCTGCTTGAGAGAAGACAAGAGGTTAGGGAGCAGCGGGAGGCATTG
CTACGACAGCGGGAGCAAGCCGCAGCTGCGGGAGAGAACACACCCGCCAACGACGAGCCCCTGCCGAGCGAGGAC
GATGTCGACGAAATGGACATTGACGTGCCCGGCTGGTCTACCAAAGGGGAATGGGTGTTATGGCTTGATCTCCTG
AGTGATATGATTAAGCTGGGCATATACGTTGCCTTCTTCTTCATGCTCCTTATGTTCTACGGCTTGCCCATACAC
ATCATGAGAGATTTGTTTATGACGTCTCGAGACTTTATCAAGAGGCTCAACGCCTTGCTGCGCTACCGTCGAGCC
ATCCAGGAAATGAACCGGTATCCCGACGCGTCCGCTGACGACCTCGCGCAGGAGAACACGTGCATTATCTGTCGC
GAAGAGATGAGGCCTTGGGACCCTGTTGAAAATCCGGGCGCCATCGATCGAGTGCGGCCCAAGAAGTTGCCTTGC
GGCCACATCCTGCATCTTGGCTGTCTCAAGAGCTGGCTCGAGCGACAGCAGGTGTGCCCAACATGCAGGAGTCCA
GTCACGGCCGATCGAGGTCGCGGTCGGCCTCCAGTCGGACCCCCCGCCCTGAGGATACAGCTCTGGCCGCCGAGG
CCGCAGGGCCAGCAGCCGCCGGCAGACGACGCGCAGCAGGGCCAAGGAAATGACGGTCCGCAGCAACGGGCGCCG
AGAGAAGGGGGACCTCGTATATTCAATCTCGGGCCCATCCGGCTCGGCTTTGGCACCAACGGCCAGCAGATCCGT
GAGCTTGCGCAGCAGTTTGGTGTGCCGCACATTGCTGGCAACCAGGCGGCAGCTGCTGCGGCAGGGGCTCAGGCC
CCGGACCAGAGCCAGACGGCGTTGGGCGACAACCTCCAAAGCATTGGTAATCTCCTCCGGCAGTCGGAGCAGATG
CTGCAGAGAGAGACGCAGCGCCTCAGCGTCCCCTGGCCGGCGGCCCATAACCTTCCGATGAACTTGCCGTTCCCG
CCAGCCCAGCAGCTTCCGGTCCCGGCGCCGGGGAACCAGACTCACCCCCTGGGCCTACCGATCTTGCCCGGCGCA
CCGTCTCGGTCTGGCAGTCCGCTCATGGCTCGTCTCGGCACGTCGGGAGCCACGGCACCGATCCCGGCCGGCAGC
GCAGACCTTCCGGAGGGATTGACGCTCCCTCCCGGATGGTCGGTGGTACCTCTTCAGAGGCTTGACGGTTCCCCG
ATCCCAGGTCCAGTCGCGCCCCAACCTCAGATGCCTCTGCACGACGGCGATGCCGCGACGAGCTCGCGCCAAACG
GCGAACGGACAGCCAGCTCCGGTGCCCGTTCCAGGCGGGACACCCAGCCATACGGGAGGAGACGTCGTTGACCCA
GAACCTCCCGCCGACGACCTCCCTTCAACGGAAGCTCGGCCGACCGTTGAGCCGGCTGCCCTCGTGGCCCCCAGT
CCCGTGATGCCCCGCTGGGGCGGCCCATCGCAGCTGTTCAACAACGGGCCCCGCCTCGGCCTTGACGAGCCCGAG
CAACAGCCGGGCGAGTCGTCGAGCGCGGAAGTGCCGCGTACGGAAGCAGGCGAGCGTGTGGACACTGAGGAGGAG
GGAGAGTCCTTGTCCAAGGGTAAGACGAAGGTGGTCGCGGTCGAAGAAGCTCACGAAGAAGAATGA
Gene >Ophio5|225
ATGCGGCTCGGCTGGTACGCTGGGGTATGTGTATTTCAGTTTCCTGTTCTCCTGGGAGACCTTTGGTCCTGACTT
GAGCTGACGGCGGGTCTAGGTCTCCACGGCCCTCGCGGGAGGCGTCGTCATCTCTGCCTTTCTGCAGCGAGCCAA
CTTTTACTCGGCCATGGTCTATCTGGCCCAGAGCAACTTTTGCTTGCTGGTATGTTTTCGTGCTTGTTCCTCTCT
GTCTGCAAGGGACAAAAGCTGACGAATGTGCCACGTCCTCCAGGCCTTGGTAAACTTTTCACTCCTTCTTTACAG
CAGCTTTATCTACGGCTTGACGCGCTTGTGCTTCGGCACGCTTCGGGCCGTCGAGGTCGAGCAGCTTACTGAGCG
AGCTTGGTTCGCCATCACCGAGACGTGCCTCGCCATGACCATTTTCAGAGAGGAAATAGGGGCCTGGTTCCTGGT
CATGTTCACGGCGTTGGTGACGGGCAAGGTGTGGGGCTGGATCGGCGATGGCCGAGTCGAGTTCCTGGAGCAGCA
GCCGCCGCAAAACCCGCGGCTCTTTCACTTTCGCCTTAGCATCTCGCTCGCCATGAGCTTCATGTACGACGTGCT
GATACTGCGATATTCGGTCCGGAACGTTATCCAACAGGCACGCCCAAACATGATGGTCATGTTCCTTTTCGAATT
CGCAGTGCTGGCCACGTGTTCTTGGCGAACAGCGGCACGCTACTTGCTCGTTCTGGCGGAACAAAACATCATCAG
GGCCCAGACGCGGAAGAGGCTGCTTGAGAGAAGACAAGAGGTTAGGGAGCAGCGGGAGGCATTGCTACGACAGCG
GGAGCAAGCCGCAGCTGCGGGAGAGAACACACCCGCCAACGACGAGCCCCTGCCGAGCGAGGACGATGTCGACGA
AATGGACATTGACGTGCCCGGCTGGTCTACCAAAGGGGAATGGGTGTTATGGCTTGATCTCCTGAGTGGTAAGAA
TGACATATCTTTCGAGTCTCTGAGTGCGTCGCTGACAGCCGGCAGATATGATTAAGCTGGGCATATACGTTGCCT
TCTTCTTCATGCTCCTTATGTTCTACGGCTTGCCCATACACATCATGAGAGATTTGTTTATGACGTCTCGAGACT
TTATCAAGAGGCTCAACGCCTTGCTGCGCTACCGTCGAGCCATCCAGGAAATGAACCGGTATCCCGACGCGTCCG
CTGACGACCTCGCGCAGGAGAACACGTGCATTATCTGTCGCGAAGAGATGAGGCCTTGGGACCCTGTTGAAAATC
CGGGCGCCATCGATCGAGTGCGGCCCAAGAAGTTGCCTTGCGGCCACATCCTGCATCTTGGCTGTCTCAAGAGCT
GGCTCGAGCGACAGCAGGTGTGCCCAACATGCAGGAGTCCAGTCACGGCCGATCGAGGTCGCGGTCGGCCTCCAG
TCGGACCCCCCGCCCTGAGGATACAGCTCTGGCCGCCGAGGCCGCAGGGCCAGCAGCCGCCGGCAGACGACGCGC
AGCAGGGCCAAGGAAATGACGGTCCGCAGCAACGGGCGCCGAGAGAAGGGGGACCTCGTATATTCAATCTCGGGC
CCATCCGGCTCGGCTTTGGCACCAACGGCCAGCAGATCCGTGAGCTTGCGCAGCAGTTTGGTGTGCCGCACATTG
CTGGCAACCAGGCGGCAGCTGCTGCGGCAGGGGCTCAGGCCCCGGACCAGAGCCAGACGGCGTTGGGCGACAACC
TCCAAAGCATTGGTAATCTCCTCCGGCAGTCGGAGCAGATGCTGCAGAGAGAGACGCAGCGCCTGCAAGTGTCCC
AGCAGGAGCTCCAGATCGCCAACCTGCTGATGAGCGAGCTGCTGCGCCTACAGCAGCGTCGTTTGCAAGCGCAGG
ACCAAATTCCGGCAGGCCAGCCTCCCCAGCCCTGGCCGGCGGCCCATAACCTTCCGATGAACTTGCCGTTCCCGC
CAGCCCAGCAGCTTCCGGTCCCGGCGCCGGGGAACCAGACTCACCCCCTGGGCCTACCGATCTTGCCCGGCGCAC
CGTCTCGGTCTGGCAGTCCGCTCATGGCTCGTCTCGGCACGTCGGGAGCCACGGCACCGATCCCGGCCGGCAGCG
CAGACCTTCCGGAGGGATTGACGCTCCCTCCCGGATGGTCGGTGGTACCTCTTCAGAGGCTTGACGGTTCCCCGA
TCCCAGGTCCAGTCGCGCCCCAACCTCAGATGCCTCTGCACGACGGCGATGCCGCGACGAGCTCGCGCCAAACGG
CGAACGGACAGCCAGCTCCGGTGCCCGTTCCAGGCGGGACACCCAGCCATACGGGAGGAGACGTCGTTGACCCAG
AACCTCCCGCCGACGACCTCCCTTCAACGGAAGCTCGGCCGACCGTTGAGCCGGCTGCCCTCGTGGCCCCCAGTC
CCGTGATGCCCCGCTGGGGCGGCCCATCGCAGCTGTTCAACAACGGGCCCCGCCTCGGCCTTGACGAGCCCGAGC
AACAGCCGGGCGAGTCGTCGAGCGCGGAAGTGCCGCGTACGGAAGCAGGCGAGCGTGTGGACACTGAGGAGGAGG
GAGAGTCCTTGTCCAAGGGTAAGACGAAGGTGGTCGCGGTCGAAGAAGCTCACGAAGAAGAATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail