Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|2237
Gene name
Locationscaffold_192:7247..10226
Strand-
Gene length (bp)2979
Transcript length (bp)2925
Coding sequence length (bp)2922
Protein length (aa) 974

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04082 Fungal_trans Fungal specific transcription factor domain 6.8E-59 477 765
PF00096 zf-C2H2 Zinc finger, C2H2 type 7.1E-04 72 96
PF00096 zf-C2H2 Zinc finger, C2H2 type 1.7E-03 102 126

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9US36|KLF1_SCHPO Zinc finger protein klf1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=klf1 PE=2 SV=1 463 966 2.0E-51
sp|Q12139|YP022_YEAST Zinc finger protein YPR022C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPR022C PE=1 SV=1 477 964 5.0E-43
sp|Q9UTS5|ZAS1_SCHPO Zinc finger protein zas1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=zas1 PE=2 SV=1 476 964 3.0E-33
sp|Q12139|YP022_YEAST Zinc finger protein YPR022C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPR022C PE=1 SV=1 69 144 7.0E-11
sp|Q9UTS5|ZAS1_SCHPO Zinc finger protein zas1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=zas1 PE=2 SV=1 57 142 1.0E-09
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9US36|KLF1_SCHPO Zinc finger protein klf1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=klf1 PE=2 SV=1 463 966 2.0E-51
sp|Q12139|YP022_YEAST Zinc finger protein YPR022C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPR022C PE=1 SV=1 477 964 5.0E-43
sp|Q9UTS5|ZAS1_SCHPO Zinc finger protein zas1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=zas1 PE=2 SV=1 476 964 3.0E-33
sp|Q12139|YP022_YEAST Zinc finger protein YPR022C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPR022C PE=1 SV=1 69 144 7.0E-11
sp|Q9UTS5|ZAS1_SCHPO Zinc finger protein zas1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=zas1 PE=2 SV=1 57 142 1.0E-09
sp|Q9US36|KLF1_SCHPO Zinc finger protein klf1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=klf1 PE=2 SV=1 59 163 3.0E-08
sp|Q5JT82|KLF17_HUMAN Krueppel-like factor 17 OS=Homo sapiens GN=KLF17 PE=1 SV=1 30 132 3.0E-08
sp|Q8TD94|KLF14_HUMAN Krueppel-like factor 14 OS=Homo sapiens GN=KLF14 PE=2 SV=1 59 126 6.0E-08
sp|Q12132|USV1_YEAST Nutrient and stress factor 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=USV1 PE=1 SV=1 62 132 8.0E-08
sp|Q19A41|KLF14_MOUSE Krueppel-like factor 14 OS=Mus musculus GN=Klf14 PE=2 SV=1 61 126 3.0E-07
sp|P46099|KLF1_MOUSE Krueppel-like factor 1 OS=Mus musculus GN=Klf1 PE=1 SV=2 58 126 5.0E-07
sp|Q59U10|BCR1_CANAL Biofilm and cell wall regulator 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=BCR1 PE=1 SV=1 58 122 5.0E-07
sp|Q19A40|KLF14_PANTR Krueppel-like factor 14 OS=Pan troglodytes GN=KLF14 PE=3 SV=1 61 126 6.0E-07
sp|Q14V87|KLF14_GORGO Krueppel-like factor 14 OS=Gorilla gorilla gorilla GN=KLF14 PE=3 SV=1 61 126 6.0E-07
sp|Q13351|KLF1_HUMAN Krueppel-like factor 1 OS=Homo sapiens GN=KLF1 PE=1 SV=1 70 126 1.0E-06
sp|O62651|WT1_PIG Wilms tumor protein homolog OS=Sus scrofa GN=WT1 PE=2 SV=1 57 126 2.0E-06
sp|P19544|WT1_HUMAN Wilms tumor protein OS=Homo sapiens GN=WT1 PE=1 SV=2 57 126 2.0E-06
sp|Q13886|KLF9_HUMAN Krueppel-like factor 9 OS=Homo sapiens GN=KLF9 PE=1 SV=1 70 126 2.0E-06
sp|P79288|KLF9_PIG Krueppel-like factor 9 OS=Sus scrofa GN=KLF9 PE=2 SV=3 70 126 2.0E-06
sp|Q01713|KLF9_RAT Krueppel-like factor 9 OS=Rattus norvegicus GN=Klf9 PE=2 SV=1 70 126 2.0E-06
sp|B7ZSG3|WT1A_XENLA Wilms tumor protein homolog A OS=Xenopus laevis GN=wt1-a PE=2 SV=1 63 127 2.0E-06
sp|P79958|WT1B_XENLA Wilms tumor protein homolog B OS=Xenopus laevis GN=wt1-b PE=2 SV=1 63 127 2.0E-06
sp|O35739|KLF9_MOUSE Krueppel-like factor 9 OS=Mus musculus GN=Klf9 PE=2 SV=1 70 126 3.0E-06
sp|P22561|WT1_MOUSE Wilms tumor protein homolog OS=Mus musculus GN=Wt1 PE=1 SV=1 57 126 3.0E-06
sp|P49952|WT1_RAT Wilms tumor protein homolog OS=Rattus norvegicus GN=Wt1 PE=2 SV=1 57 126 3.0E-06
sp|P52747|ZN143_HUMAN Zinc finger protein 143 OS=Homo sapiens GN=ZNF143 PE=1 SV=2 63 142 3.0E-06
sp|Q8CFA7|KLF17_MOUSE Krueppel-like factor 17 OS=Mus musculus GN=Klf17 PE=1 SV=2 63 132 3.0E-06
sp|A6QQW0|ZN143_BOVIN Zinc finger protein 143 OS=Bos taurus GN=ZNF143 PE=2 SV=1 63 142 4.0E-06
sp|P50902|WT1_ALLMI Wilms tumor protein homolog (Fragment) OS=Alligator mississippiensis GN=WT1 PE=2 SV=1 57 127 4.0E-06
sp|B5DE03|WT1_XENTR Wilms tumor protein homolog OS=Xenopus tropicalis GN=wt1 PE=2 SV=1 72 127 4.0E-06
sp|O70230|ZN143_MOUSE Zinc finger protein 143 OS=Mus musculus GN=Znf143 PE=1 SV=2 63 142 4.0E-06
sp|P49953|WT1_SMIMA Wilms tumor protein homolog (Fragment) OS=Sminthopsis macroura GN=WT1 PE=2 SV=1 72 127 4.0E-06
sp|Q5XIU2|ZN143_RAT Zinc finger protein 143 OS=Rattus norvegicus GN=Znf143 PE=2 SV=2 63 142 4.0E-06
sp|P19538|CI_DROME Transcriptional activator cubitus interruptus OS=Drosophila melanogaster GN=ci PE=1 SV=2 70 135 5.0E-06
sp|P36508|ZNF76_HUMAN Zinc finger protein 76 OS=Homo sapiens GN=ZNF76 PE=2 SV=2 36 132 5.0E-06
sp|Q62445|SP4_MOUSE Transcription factor Sp4 OS=Mus musculus GN=Sp4 PE=2 SV=2 12 130 6.0E-06
sp|Q9YIB7|ZIC2B_XENLA Zinc finger protein ZIC 2-B OS=Xenopus laevis GN=zic2-b PE=2 SV=1 70 135 6.0E-06
sp|Q91689|ZIC2A_XENLA Zinc finger protein ZIC 2-A OS=Xenopus laevis GN=zic2-a PE=2 SV=2 70 135 7.0E-06
sp|O95409|ZIC2_HUMAN Zinc finger protein ZIC 2 OS=Homo sapiens GN=ZIC2 PE=1 SV=2 70 133 9.0E-06
sp|Q62520|ZIC2_MOUSE Zinc finger protein ZIC 2 OS=Mus musculus GN=Zic2 PE=1 SV=2 70 135 9.0E-06
sp|Q91853|ZN143_XENLA Zinc finger protein 143 OS=Xenopus laevis GN=znf143 PE=1 SV=2 50 132 1.0E-05
sp|O73689|ZIC1_XENLA Zinc finger protein ZIC 1 OS=Xenopus laevis GN=zic1 PE=2 SV=1 70 135 1.0E-05
sp|C7EMF5|KLF17_PIG Krueppel-like factor 17 OS=Sus scrofa GN=KLF17 PE=2 SV=1 68 132 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0006351 transcription, DNA-templated Yes
GO:0008270 zinc ion binding Yes
GO:0003677 DNA binding Yes
GO:0046872 metal ion binding No
GO:0003674 molecular_function No
GO:0044237 cellular metabolic process No
GO:0043169 cation binding No
GO:0043167 ion binding No
GO:0008152 metabolic process No
GO:0006139 nucleobase-containing compound metabolic process No
GO:1901576 organic substance biosynthetic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0046483 heterocycle metabolic process No
GO:0003676 nucleic acid binding No
GO:0090304 nucleic acid metabolic process No
GO:0044238 primary metabolic process No
GO:0018130 heterocycle biosynthetic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0008150 biological_process No
GO:0019438 aromatic compound biosynthetic process No
GO:0016070 RNA metabolic process No
GO:0009058 biosynthetic process No
GO:0044249 cellular biosynthetic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:1901362 organic cyclic compound biosynthetic process No
GO:0046914 transition metal ion binding No
GO:0097159 organic cyclic compound binding No
GO:0034654 nucleobase-containing compound biosynthetic process No
GO:0071704 organic substance metabolic process No
GO:0097659 nucleic acid-templated transcription No
GO:0009059 macromolecule biosynthetic process No
GO:1901363 heterocyclic compound binding No
GO:0044271 cellular nitrogen compound biosynthetic process No
GO:0032774 RNA biosynthetic process No
GO:0009987 cellular process No
GO:0043170 macromolecule metabolic process No
GO:0005488 binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 14 0.45

Transmembrane Domains

(None)

Transcription Factor Class

Transcription Factor Class
(based on PFAM domains)
Fungal Specific TF
C2H2 zinc finger

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|2237
MMASAAPSPPADGQPFYPVSVASPTTGVGHDARVASPDDPMLVSQNEWRLGDDADLPVAKKKRSRKGLGKRFECT
AEGCGKSYSRAEHLYRHQLNHNSRQIFYCEYPDCPRTFVRGDLLKRHMDRHAHKGPHLGRRDALSASQQMPPGMS
LSEEAAAEGQHADAATGSRHQLNLGYQSPQDQSRCSPFTATSNTPPGATCVGSPPTNAGEGYRPDASHGISRSSP
SPFQPSLDPYEAFGPREAGYQTHLSSHLSASFVSQHGAETMRLPQSRFPGLPIRRCASQTFMDPASTQYPDSLCE
PPMVTLSPMVMQGTGQMFGHHQGLGKPPCVGMPEDFMAYLFTSLPSSGSSSAVLATSTVASKEVMAHGHRWPRTG
DDDGYGDAQSHQYAGQSLRGGLSVGGFSAEPQQVMAVDKLLEQDGAEATLSEGKSRELFELIKDRFHEHSMSPTE
RRRDGIVGTGRAEGDDVLSRRMMQIYLSSYWHHFSDQVPILHKPTFSPEQTPNLLLLAMMTLGAACLDRISSRPS
TAAASANVSDFLARHLRWEIFTDQSFRPPAKLWVFQALILLELYEKMYSTREMHERAHVHHGSLITLMRRGRSLV
GKSGPDSPPEGQIGAKDGQDGWWRDWVAAEAMRRVAYAALVVDATHVVMFGHSGVMAAHELNLTLPCDEALWRAR
TSAEFGRIESTMASQGIKTTSFFEGLKRTLSHAQVPTTPFGRTVLMSGLLSVTYHMNQLDLEVDILGGNTLEAAR
DSWRTTMTAAYDFWKADFDRASNREGESSMMHASRSVLHHLAHMATHADIVDCQIFAGAKRLLGRVIGPHEHNAS
RRRICDSWARTARARDATFHALKFLASVLLRGPYEARSDVLMNRPWVLYFAVLIVWCYGFALEGPCPTTAAATMG
PAEARRAMRGYLLRCGGGVASPSELQGLRGVNENTALLVVLRESFEKSRWDLLREAAQLLRNCLVLNAGGAIAV
Coding >Ophio5|2237
ATGATGGCTTCTGCCGCTCCCTCCCCCCCAGCAGACGGCCAGCCCTTCTACCCTGTTTCGGTGGCGAGCCCGACC
ACTGGCGTGGGACATGACGCCAGAGTCGCCTCTCCCGACGACCCGATGCTCGTAAGCCAGAACGAATGGAGACTC
GGGGATGACGCAGACTTGCCGGTGGCCAAGAAGAAACGCAGCCGCAAGGGGCTGGGTAAGCGATTCGAATGCACG
GCAGAGGGCTGCGGCAAAAGCTACTCGAGGGCAGAGCATCTATATCGTCACCAGCTGAATCACAACTCGCGCCAA
ATCTTCTATTGCGAGTACCCCGACTGTCCTCGAACCTTTGTTCGCGGAGACTTGTTGAAGCGACACATGGATCGT
CATGCCCACAAGGGCCCTCACCTCGGACGCAGAGATGCCCTGTCCGCCAGCCAACAAATGCCGCCTGGCATGTCC
TTGTCCGAGGAGGCCGCGGCGGAAGGCCAGCACGCTGATGCCGCCACCGGGTCTAGGCATCAACTGAACTTGGGT
TACCAGTCTCCCCAAGACCAGTCGAGATGCAGCCCCTTTACGGCTACCAGCAACACGCCGCCAGGAGCGACTTGT
GTGGGCTCTCCGCCTACCAACGCCGGTGAAGGTTACCGGCCAGATGCTTCACACGGCATTTCTCGAAGCTCGCCA
TCGCCCTTTCAGCCGAGCCTGGATCCTTACGAAGCCTTTGGCCCACGCGAGGCCGGCTACCAGACGCACCTTTCA
TCCCATCTCTCGGCGTCTTTCGTGTCTCAACATGGTGCAGAGACGATGCGTCTGCCTCAAAGCCGGTTCCCCGGC
TTGCCAATACGTCGATGTGCGAGCCAGACCTTCATGGACCCCGCGTCGACGCAGTACCCGGACTCGCTTTGCGAG
CCCCCCATGGTAACGCTCAGCCCGATGGTGATGCAGGGCACGGGGCAAATGTTTGGGCATCATCAGGGGCTGGGA
AAGCCGCCTTGCGTGGGCATGCCCGAAGACTTTATGGCCTATCTCTTCACCTCTCTGCCCAGCAGTGGCTCCTCC
TCGGCCGTTCTCGCAACGTCGACTGTGGCGTCCAAGGAGGTAATGGCGCACGGGCATCGGTGGCCTCGGACTGGT
GACGATGATGGCTATGGCGACGCGCAGAGCCATCAGTATGCTGGCCAAAGCCTCAGGGGCGGCCTGTCTGTCGGC
GGCTTCTCGGCCGAGCCACAGCAGGTCATGGCCGTCGATAAGTTACTGGAGCAGGATGGTGCCGAGGCCACTCTC
TCAGAGGGGAAGAGCAGGGAGCTGTTTGAGCTGATCAAGGATCGCTTCCACGAACACAGCATGTCGCCCACGGAG
CGGCGGAGAGACGGCATCGTCGGAACAGGTCGAGCCGAGGGCGACGACGTCCTGAGCCGAAGAATGATGCAGATA
TACCTCAGCTCGTACTGGCATCACTTTAGCGACCAGGTGCCGATACTGCACAAGCCCACCTTCTCGCCTGAGCAG
ACGCCCAACCTGCTCCTCCTGGCCATGATGACGCTGGGAGCCGCCTGTCTGGACAGGATATCCAGCCGGCCCTCG
ACGGCAGCAGCCTCGGCCAACGTGTCCGACTTTTTGGCCCGCCATCTGCGCTGGGAGATCTTCACGGACCAGAGC
TTCCGACCGCCGGCGAAGCTGTGGGTGTTTCAGGCCCTGATACTGCTGGAGCTGTACGAGAAGATGTACTCGACG
CGAGAGATGCACGAGCGAGCTCATGTCCATCACGGAAGCCTGATTACGCTCATGCGTCGCGGCCGGTCTTTGGTA
GGCAAGTCTGGGCCCGACTCGCCGCCGGAAGGTCAGATAGGGGCCAAGGATGGCCAGGATGGCTGGTGGCGCGAC
TGGGTCGCGGCTGAGGCTATGCGGCGTGTGGCCTATGCCGCCTTGGTGGTGGACGCGACACACGTCGTCATGTTT
GGCCACTCGGGCGTCATGGCAGCTCACGAGCTGAATCTGACGCTGCCCTGCGATGAGGCGCTGTGGCGAGCCCGG
ACCAGCGCCGAGTTTGGGCGGATAGAGTCGACCATGGCGTCTCAGGGCATCAAGACGACCTCCTTTTTCGAGGGA
CTCAAGCGTACGCTGAGCCACGCCCAAGTGCCAACGACGCCCTTTGGCCGGACCGTTCTCATGTCTGGCCTGCTC
AGCGTCACCTACCACATGAATCAGCTGGATCTAGAGGTCGACATTCTCGGCGGAAACACGCTCGAGGCAGCCCGG
GACTCGTGGAGGACGACGATGACGGCTGCCTACGACTTCTGGAAGGCCGACTTTGACAGGGCGTCGAATCGAGAG
GGCGAGTCAAGCATGATGCATGCGAGTCGTTCGGTGCTGCATCATCTCGCACACATGGCCACACACGCAGATATA
GTCGACTGCCAGATCTTTGCCGGTGCGAAGCGGCTTCTAGGCCGCGTCATCGGCCCTCACGAGCATAACGCGTCG
CGGAGGCGCATCTGCGACTCGTGGGCGCGCACGGCACGAGCTCGAGACGCGACCTTTCACGCCCTCAAGTTCCTC
GCCTCGGTGCTGCTTCGAGGACCGTACGAGGCGCGAAGCGACGTGCTGATGAACCGGCCGTGGGTCTTGTACTTT
GCCGTCTTGATTGTCTGGTGCTATGGATTTGCTCTCGAAGGGCCGTGTCCTACCACGGCCGCTGCGACCATGGGA
CCGGCGGAAGCGAGGCGAGCGATGCGTGGCTATCTGCTCCGATGTGGAGGCGGCGTTGCGAGTCCGAGTGAGCTG
CAGGGGCTGAGGGGGGTCAACGAGAATACGGCCTTGTTGGTGGTGCTGAGGGAGTCTTTCGAGAAGTCGAGGTGG
GATTTGTTGCGGGAGGCGGCCCAGCTGTTGAGGAACTGTCTTGTCCTTAATGCCGGAGGGGCGATCGCAGTA
Transcript >Ophio5|2237
ATGATGGCTTCTGCCGCTCCCTCCCCCCCAGCAGACGGCCAGCCCTTCTACCCTGTTTCGGTGGCGAGCCCGACC
ACTGGCGTGGGACATGACGCCAGAGTCGCCTCTCCCGACGACCCGATGCTCGTAAGCCAGAACGAATGGAGACTC
GGGGATGACGCAGACTTGCCGGTGGCCAAGAAGAAACGCAGCCGCAAGGGGCTGGGTAAGCGATTCGAATGCACG
GCAGAGGGCTGCGGCAAAAGCTACTCGAGGGCAGAGCATCTATATCGTCACCAGCTGAATCACAACTCGCGCCAA
ATCTTCTATTGCGAGTACCCCGACTGTCCTCGAACCTTTGTTCGCGGAGACTTGTTGAAGCGACACATGGATCGT
CATGCCCACAAGGGCCCTCACCTCGGACGCAGAGATGCCCTGTCCGCCAGCCAACAAATGCCGCCTGGCATGTCC
TTGTCCGAGGAGGCCGCGGCGGAAGGCCAGCACGCTGATGCCGCCACCGGGTCTAGGCATCAACTGAACTTGGGT
TACCAGTCTCCCCAAGACCAGTCGAGATGCAGCCCCTTTACGGCTACCAGCAACACGCCGCCAGGAGCGACTTGT
GTGGGCTCTCCGCCTACCAACGCCGGTGAAGGTTACCGGCCAGATGCTTCACACGGCATTTCTCGAAGCTCGCCA
TCGCCCTTTCAGCCGAGCCTGGATCCTTACGAAGCCTTTGGCCCACGCGAGGCCGGCTACCAGACGCACCTTTCA
TCCCATCTCTCGGCGTCTTTCGTGTCTCAACATGGTGCAGAGACGATGCGTCTGCCTCAAAGCCGGTTCCCCGGC
TTGCCAATACGTCGATGTGCGAGCCAGACCTTCATGGACCCCGCGTCGACGCAGTACCCGGACTCGCTTTGCGAG
CCCCCCATGGTAACGCTCAGCCCGATGGTGATGCAGGGCACGGGGCAAATGTTTGGGCATCATCAGGGGCTGGGA
AAGCCGCCTTGCGTGGGCATGCCCGAAGACTTTATGGCCTATCTCTTCACCTCTCTGCCCAGCAGTGGCTCCTCC
TCGGCCGTTCTCGCAACGTCGACTGTGGCGTCCAAGGAGGTAATGGCGCACGGGCATCGGTGGCCTCGGACTGGT
GACGATGATGGCTATGGCGACGCGCAGAGCCATCAGTATGCTGGCCAAAGCCTCAGGGGCGGCCTGTCTGTCGGC
GGCTTCTCGGCCGAGCCACAGCAGGTCATGGCCGTCGATAAGTTACTGGAGCAGGATGGTGCCGAGGCCACTCTC
TCAGAGGGGAAGAGCAGGGAGCTGTTTGAGCTGATCAAGGATCGCTTCCACGAACACAGCATGTCGCCCACGGAG
CGGCGGAGAGACGGCATCGTCGGAACAGGTCGAGCCGAGGGCGACGACGTCCTGAGCCGAAGAATGATGCAGATA
TACCTCAGCTCGTACTGGCATCACTTTAGCGACCAGGTGCCGATACTGCACAAGCCCACCTTCTCGCCTGAGCAG
ACGCCCAACCTGCTCCTCCTGGCCATGATGACGCTGGGAGCCGCCTGTCTGGACAGGATATCCAGCCGGCCCTCG
ACGGCAGCAGCCTCGGCCAACGTGTCCGACTTTTTGGCCCGCCATCTGCGCTGGGAGATCTTCACGGACCAGAGC
TTCCGACCGCCGGCGAAGCTGTGGGTGTTTCAGGCCCTGATACTGCTGGAGCTGTACGAGAAGATGTACTCGACG
CGAGAGATGCACGAGCGAGCTCATGTCCATCACGGAAGCCTGATTACGCTCATGCGTCGCGGCCGGTCTTTGGTA
GGCAAGTCTGGGCCCGACTCGCCGCCGGAAGGTCAGATAGGGGCCAAGGATGGCCAGGATGGCTGGTGGCGCGAC
TGGGTCGCGGCTGAGGCTATGCGGCGTGTGGCCTATGCCGCCTTGGTGGTGGACGCGACACACGTCGTCATGTTT
GGCCACTCGGGCGTCATGGCAGCTCACGAGCTGAATCTGACGCTGCCCTGCGATGAGGCGCTGTGGCGAGCCCGG
ACCAGCGCCGAGTTTGGGCGGATAGAGTCGACCATGGCGTCTCAGGGCATCAAGACGACCTCCTTTTTCGAGGGA
CTCAAGCGTACGCTGAGCCACGCCCAAGTGCCAACGACGCCCTTTGGCCGGACCGTTCTCATGTCTGGCCTGCTC
AGCGTCACCTACCACATGAATCAGCTGGATCTAGAGGTCGACATTCTCGGCGGAAACACGCTCGAGGCAGCCCGG
GACTCGTGGAGGACGACGATGACGGCTGCCTACGACTTCTGGAAGGCCGACTTTGACAGGGCGTCGAATCGAGAG
GGCGAGTCAAGCATGATGCATGCGAGTCGTTCGGTGCTGCATCATCTCGCACACATGGCCACACACGCAGATATA
GTCGACTGCCAGATCTTTGCCGGTGCGAAGCGGCTTCTAGGCCGCGTCATCGGCCCTCACGAGCATAACGCGTCG
CGGAGGCGCATCTGCGACTCGTGGGCGCGCACGGCACGAGCTCGAGACGCGACCTTTCACGCCCTCAAGTTCCTC
GCCTCGGTGCTGCTTCGAGGACCGTACGAGGCGCGAAGCGACGTGCTGATGAACCGGCCGTGGGTCTTGTACTTT
GCCGTCTTGATTGTCTGGTGCTATGGATTTGCTCTCGAAGGGCCGTGTCCTACCACGGCCGCTGCGACCATGGGA
CCGGCGGAAGCGAGGCGAGCGATGCGTGGCTATCTGCTCCGATGTGGAGGCGGCGTTGCGAGTCCGAGTGAGCTG
CAGGGGCTGAGGGGGGTCAACGAGAATACGGCCTTGTTGGTGGTGCTGAGGGAGTCTTTCGAGAAGTCGAGGTGG
GATTTGTTGCGGGAGGCGGCCCAGCTGTTGAGGAACTGTCTTGTCCTTAATGCCGGAGGGGCGATCGCAGTATAA
Gene >Ophio5|2237
ATGATGGCTTCTGCCGCTCCCTCCCCCCCAGCAGACGGCCAGCCCTTCTACCCTGTTTCGGTGGCGAGCCCGACC
ACTGGCGTGGGACATGACGCCAGAGTCGCCTCTCCCGACGACCCGATGCTCGTAAGCCAGAACGAATGGAGACTC
GGGGATGACGCAGACTTGCCGGTGGCCAAGAAGAAACGCAGCCGCAAGGGGCTGGGTAAGCGATTCGAATGCACG
GCAGAGGGCTGCGGCAAAAGCTACTCGAGGGCAGAGCATCTGTAGGGAAACCAAATCCTCGCCCCCCTTGTCGTG
CCGTGCTGACGGCAGCGTAGATATCGTCACCAGCTGAATCACAACTCGCGCCAAATCTTCTATTGCGAGTACCCC
GACTGTCCTCGAACCTTTGTTCGCGGAGACTTGTTGAAGCGACACATGGATCGTCATGCCCACAAGGGCCCTCAC
CTCGGACGCAGAGATGCCCTGTCCGCCAGCCAACAAATGCCGCCTGGCATGTCCTTGTCCGAGGAGGCCGCGGCG
GAAGGCCAGCACGCTGATGCCGCCACCGGGTCTAGGCATCAACTGAACTTGGGTTACCAGTCTCCCCAAGACCAG
TCGAGATGCAGCCCCTTTACGGCTACCAGCAACACGCCGCCAGGAGCGACTTGTGTGGGCTCTCCGCCTACCAAC
GCCGGTGAAGGTTACCGGCCAGATGCTTCACACGGCATTTCTCGAAGCTCGCCATCGCCCTTTCAGCCGAGCCTG
GATCCTTACGAAGCCTTTGGCCCACGCGAGGCCGGCTACCAGACGCACCTTTCATCCCATCTCTCGGCGTCTTTC
GTGTCTCAACATGGTGCAGAGACGATGCGTCTGCCTCAAAGCCGGTTCCCCGGCTTGCCAATACGTCGATGTGCG
AGCCAGACCTTCATGGACCCCGCGTCGACGCAGTACCCGGACTCGCTTTGCGAGCCCCCCATGGTAACGCTCAGC
CCGATGGTGATGCAGGGCACGGGGCAAATGTTTGGGCATCATCAGGGGCTGGGAAAGCCGCCTTGCGTGGGCATG
CCCGAAGACTTTATGGCCTATCTCTTCACCTCTCTGCCCAGCAGTGGCTCCTCCTCGGCCGTTCTCGCAACGTCG
ACTGTGGCGTCCAAGGAGGTAATGGCGCACGGGCATCGGTGGCCTCGGACTGGTGACGATGATGGCTATGGCGAC
GCGCAGAGCCATCAGTATGCTGGCCAAAGCCTCAGGGGCGGCCTGTCTGTCGGCGGCTTCTCGGCCGAGCCACAG
CAGGTCATGGCCGTCGATAAGTTACTGGAGCAGGATGGTGCCGAGGCCACTCTCTCAGAGGGGAAGAGCAGGGAG
CTGTTTGAGCTGATCAAGGATCGCTTCCACGAACACAGCATGTCGCCCACGGAGCGGCGGAGAGACGGCATCGTC
GGAACAGGTCGAGCCGAGGGCGACGACGTCCTGAGCCGAAGAATGATGCAGATATACCTCAGCTCGTACTGGCAT
CACTTTAGCGACCAGGTGCCGATACTGCACAAGCCCACCTTCTCGCCTGAGCAGACGCCCAACCTGCTCCTCCTG
GCCATGATGACGCTGGGAGCCGCCTGTCTGGACAGGATATCCAGCCGGCCCTCGACGGCAGCAGCCTCGGCCAAC
GTGTCCGACTTTTTGGCCCGCCATCTGCGCTGGGAGATCTTCACGGACCAGAGCTTCCGACCGCCGGCGAAGCTG
TGGGTGTTTCAGGCCCTGATACTGCTGGAGCTGTACGAGAAGATGTACTCGACGCGAGAGATGCACGAGCGAGCT
CATGTCCATCACGGAAGCCTGATTACGCTCATGCGTCGCGGCCGGTCTTTGGTAGGCAAGTCTGGGCCCGACTCG
CCGCCGGAAGGTCAGATAGGGGCCAAGGATGGCCAGGATGGCTGGTGGCGCGACTGGGTCGCGGCTGAGGCTATG
CGGCGTGTGGCCTATGCCGCCTTGGTGGTGGACGCGACACACGTCGTCATGTTTGGCCACTCGGGCGTCATGGCA
GCTCACGAGCTGAATCTGACGCTGCCCTGCGATGAGGCGCTGTGGCGAGCCCGGACCAGCGCCGAGTTTGGGCGG
ATAGAGTCGACCATGGCGTCTCAGGGCATCAAGACGACCTCCTTTTTCGAGGGACTCAAGCGTACGCTGAGCCAC
GCCCAAGTGCCAACGACGCCCTTTGGCCGGACCGTTCTCATGTCTGGCCTGCTCAGCGTCACCTACCACATGAAT
CAGCTGGATCTAGAGGTCGACATTCTCGGCGGAAACACGCTCGAGGCAGCCCGGGACTCGTGGAGGACGACGATG
ACGGCTGCCTACGACTTCTGGAAGGCCGACTTTGACAGGGCGTCGAATCGAGAGGGCGAGTCAAGCATGATGCAT
GCGAGTCGTTCGGTGCTGCATCATCTCGCACACATGGCCACACACGCAGATATAGTCGACTGCCAGATCTTTGCC
GGTGCGAAGCGGCTTCTAGGCCGCGTCATCGGCCCTCACGAGCATAACGCGTCGCGGAGGCGCATCTGCGACTCG
TGGGCGCGCACGGCACGAGCTCGAGACGCGACCTTTCACGCCCTCAAGTTCCTCGCCTCGGTGCTGCTTCGAGGA
CCGTACGAGGCGCGAAGCGACGTGCTGATGAACCGGCCGTGGGTCTTGTACTTTGCCGTCTTGATTGTCTGGTGC
TATGGATTTGCTCTCGAAGGGCCGTGTCCTACCACGGCCGCTGCGACCATGGGACCGGCGGAAGCGAGGCGAGCG
ATGCGTGGCTATCTGCTCCGATGTGGAGGCGGCGTTGCGAGTCCGAGTGAGCTGCAGGGGCTGAGGGGGGTCAAC
GAGAATACGGCCTTGTTGGTGGTGCTGAGGGAGTCTTTCGAGAAGTCGAGGTGGGATTTGTTGCGGGAGGCGGCC
CAGCTGTTGAGGAACTGTCTTGTCCTTAATGCCGGAGGGGCGATCGCAGTATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail