Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|2235
Gene name
Locationscaffold_192:5616..6240
Strand-
Gene length (bp)624
Transcript length (bp)534
Coding sequence length (bp)531
Protein length (aa) 177

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03061 4HBT Thioesterase superfamily 5.1E-14 82 160

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q9CQR4|ACO13_MOUSE Acyl-coenzyme A thioesterase 13 OS=Mus musculus GN=Acot13 PE=1 SV=1 60 168 3.0E-12
sp|Q5R833|ACO13_PONAB Acyl-coenzyme A thioesterase 13 OS=Pongo abelii GN=ACOT13 PE=2 SV=1 60 168 4.0E-11
sp|Q9NPJ3|ACO13_HUMAN Acyl-coenzyme A thioesterase 13 OS=Homo sapiens GN=ACOT13 PE=1 SV=1 60 168 4.0E-11
sp|P34419|YLZ6_CAEEL Putative esterase F42H10.6 OS=Caenorhabditis elegans GN=F42H10.6 PE=1 SV=2 72 166 6.0E-08

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Peroxisome Peroxisomal targeting signal 0.5124 0.5081 0.0364 0.038 0.1295 0.0027 0.1783 0.1542 0.0267 0.953

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup5696
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4284
Ophiocordyceps australis map64 (Brazil) OphauB2|1233
Ophiocordyceps camponoti-floridani Ophcf2|02775
Ophiocordyceps kimflemingae Ophio5|2235 (this protein)
Ophiocordyceps subramaniannii Hirsu2|8674

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|2235
MSSSENDSSSSSRDALENGDPSEKIKAWLELTRNSQGHLIAGDYMAALIPHLHLHTVSPTARPPSATFVYTVQAD
HCNRMRSLHGGAAATLFDYCTTLVLVLVSRPGFWSYLGVSRSLNVTYLRPATCGQELLIECQLLQVGKRLATLRG
TMRRRSDGEVLSVCEHGKANIDPEMKL
Coding >Ophio5|2235
ATGTCGTCGTCCGAAAACGACTCCTCCTCTAGCAGCCGCGACGCCCTCGAAAATGGCGACCCCTCGGAAAAGATC
AAGGCCTGGCTAGAGCTCACGCGCAATAGCCAAGGTCATCTCATAGCCGGAGACTACATGGCAGCCTTAATCCCC
CATCTTCATCTACACACCGTCTCGCCCACGGCACGTCCTCCATCCGCCACCTTCGTCTACACCGTGCAGGCGGAC
CACTGCAACCGGATGCGCAGCCTGCACGGAGGCGCCGCCGCTACGTTGTTTGACTACTGCACAACCCTGGTTCTC
GTCCTCGTCAGTCGGCCTGGCTTCTGGAGTTATCTGGGTGTTAGCCGCTCGCTTAACGTCACGTATCTGCGTCCT
GCCACGTGCGGCCAAGAGCTTCTTATTGAGTGCCAACTTCTGCAGGTGGGCAAGAGGCTGGCCACCCTGAGGGGT
ACCATGAGGAGGAGGAGCGATGGCGAGGTCTTGAGTGTGTGTGAGCATGGCAAGGCTAACATTGACCCTGAAATG
AAGCTG
Transcript >Ophio5|2235
ATGTCGTCGTCCGAAAACGACTCCTCCTCTAGCAGCCGCGACGCCCTCGAAAATGGCGACCCCTCGGAAAAGATC
AAGGCCTGGCTAGAGCTCACGCGCAATAGCCAAGGTCATCTCATAGCCGGAGACTACATGGCAGCCTTAATCCCC
CATCTTCATCTACACACCGTCTCGCCCACGGCACGTCCTCCATCCGCCACCTTCGTCTACACCGTGCAGGCGGAC
CACTGCAACCGGATGCGCAGCCTGCACGGAGGCGCCGCCGCTACGTTGTTTGACTACTGCACAACCCTGGTTCTC
GTCCTCGTCAGTCGGCCTGGCTTCTGGAGTTATCTGGGTGTTAGCCGCTCGCTTAACGTCACGTATCTGCGTCCT
GCCACGTGCGGCCAAGAGCTTCTTATTGAGTGCCAACTTCTGCAGGTGGGCAAGAGGCTGGCCACCCTGAGGGGT
ACCATGAGGAGGAGGAGCGATGGCGAGGTCTTGAGTGTGTGTGAGCATGGCAAGGCTAACATTGACCCTGAAATG
AAGCTGTAA
Gene >Ophio5|2235
ATGTCGTCGTCCGAAAACGACTCCTCCTCTAGCAGCCGCGACGCCCTCGAAAATGGCGACCCCTCGGAAAAGATC
AAGGCCTGGCTAGAGCTCACGCGCAATAGCCAAGGTCATCTCATAGCCGGAGTAAAGAAGCCTTCCCCCCCCCCC
CCCCGGGTGTTGTTCATTCCATTTCCTTTTGCTACTCCCTTTTAATCGTCCTACGCAATATCTCAGGACTACATG
GCAGCCTTAATCCCCCATCTTCATCTACACACCGTCTCGCCCACGGCACGTCCTCCATCCGCCACCTTCGTCTAC
ACCGTGCAGGCGGACCACTGCAACCGGATGCGCAGCCTGCACGGAGGCGCCGCCGCTACGTTGTTTGACTACTGC
ACAACCCTGGTTCTCGTCCTCGTCAGTCGGCCTGGCTTCTGGAGTTATCTGGGTGTTAGCCGCTCGCTTAACGTC
ACGTATCTGCGTCCTGCCACGTGCGGCCAAGAGCTTCTTATTGAGTGCCAACTTCTGCAGGTGGGCAAGAGGCTG
GCCACCCTGAGGGGTACCATGAGGAGGAGGAGCGATGGCGAGGTCTTGAGTGTGTGTGAGCATGGCAAGGCTAAC
ATTGACCCTGAAATGAAGCTGTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail