Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|223
Gene name
Locationscaffold_104:29693..30977
Strand+
Gene length (bp)1284
Transcript length (bp)1284
Coding sequence length (bp)1281
Protein length (aa) 427

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01545 Cation_efflux Cation efflux family 9.2E-15 144 324
PF16916 ZT_dimer Dimerisation domain of Zinc Transporter 1.4E-10 349 412

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q6Z7K5|MTP3_ORYSJ Metal tolerance protein 3 OS=Oryza sativa subsp. japonica GN=MTP3 PE=2 SV=1 103 421 2.0E-55
sp|Q5NA18|MTP5_ORYSJ Metal tolerance protein 5 OS=Oryza sativa subsp. japonica GN=MTP5 PE=2 SV=1 89 426 2.0E-52
sp|Q10PP8|MTP4_ORYSJ Metal tolerance protein 4 OS=Oryza sativa subsp. japonica GN=MTP4 PE=2 SV=1 83 427 6.0E-52
sp|Q9SAJ7|MTP9_ARATH Metal tolerance protein 9 OS=Arabidopsis thaliana GN=MTP9 PE=2 SV=2 91 421 6.0E-50
sp|Q0WU02|MTP10_ARATH Metal tolerance protein 10 OS=Arabidopsis thaliana GN=MTP10 PE=2 SV=1 91 421 5.0E-49
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q6Z7K5|MTP3_ORYSJ Metal tolerance protein 3 OS=Oryza sativa subsp. japonica GN=MTP3 PE=2 SV=1 103 421 2.0E-55
sp|Q5NA18|MTP5_ORYSJ Metal tolerance protein 5 OS=Oryza sativa subsp. japonica GN=MTP5 PE=2 SV=1 89 426 2.0E-52
sp|Q10PP8|MTP4_ORYSJ Metal tolerance protein 4 OS=Oryza sativa subsp. japonica GN=MTP4 PE=2 SV=1 83 427 6.0E-52
sp|Q9SAJ7|MTP9_ARATH Metal tolerance protein 9 OS=Arabidopsis thaliana GN=MTP9 PE=2 SV=2 91 421 6.0E-50
sp|Q0WU02|MTP10_ARATH Metal tolerance protein 10 OS=Arabidopsis thaliana GN=MTP10 PE=2 SV=1 91 421 5.0E-49
sp|Q9LDU0|MTP7_ORYSJ Metal tolerance protein 7 OS=Oryza sativa subsp. japonica GN=MTP7 PE=2 SV=1 92 421 3.0E-47
sp|Q9M2P2|MTPC3_ARATH Putative metal tolerance protein C3 OS=Arabidopsis thaliana GN=MTPC3 PE=3 SV=2 146 427 1.0E-46
sp|O80632|MTP11_ARATH Metal tolerance protein 11 OS=Arabidopsis thaliana GN=MTP11 PE=2 SV=1 100 422 9.0E-38
sp|Q0DHJ5|MTP6_ORYSJ Metal tolerance protein 6 OS=Oryza sativa subsp. japonica GN=MTP6 PE=2 SV=2 146 422 3.0E-33
sp|Q57891|Y449_METJA Uncharacterized transporter MJ0449 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ0449 PE=3 SV=1 302 412 2.0E-08
sp|B5XZ41|FIEF_KLEP3 Cation-efflux pump FieF OS=Klebsiella pneumoniae (strain 342) GN=fieF PE=3 SV=1 153 402 5.0E-08
sp|Q8RR17|FIEF_KLEPN Cation-efflux pump FieF OS=Klebsiella pneumoniae GN=fieF PE=3 SV=1 153 402 5.0E-07
sp|A6TGB7|FIEF_KLEP7 Cation-efflux pump FieF OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=fieF PE=3 SV=1 153 402 5.0E-07
sp|A8AL14|FIEF_CITK8 Cation-efflux pump FieF OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=fieF PE=3 SV=1 137 402 7.0E-07
sp|A8GLB1|FIEF_SERP5 Cation-efflux pump FieF OS=Serratia proteamaculans (strain 568) GN=fieF PE=3 SV=1 153 412 1.0E-06
sp|Q8L725|MTPC1_ARATH Metal tolerance protein C1 OS=Arabidopsis thaliana GN=MTPC1 PE=2 SV=1 144 412 3.0E-06
sp|A7MQ82|FIEF_CROS8 Cation-efflux pump FieF OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=fieF PE=3 SV=1 153 402 8.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0055085 transmembrane transport Yes
GO:0006812 cation transport Yes
GO:0008324 cation transmembrane transporter activity Yes
GO:0015075 ion transmembrane transporter activity No
GO:0006810 transport No
GO:0051179 localization No
GO:0003674 molecular_function No
GO:0005575 cellular_component No
GO:0005215 transporter activity No
GO:0008150 biological_process No
GO:0031224 intrinsic component of membrane No
GO:0110165 cellular anatomical entity No
GO:0022857 transmembrane transporter activity No
GO:0051234 establishment of localization No
GO:0009987 cellular process No
GO:0006811 ion transport No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

Domain # Start End Length
1 138 160 22
2 164 186 22
3 207 229 22
4 244 266 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|223
MSSFGRGRSPTRREAMTAPLERIASQMTDVESQKTGCETRTDGPSVESDPYDLRSGFKSASDLARVDNKSIRQNI
ARVLQRARPATKEMARGPRRSPRKVRGFYEKQNEAIERMLKPVEEHRADARREQGNDQVRYRVAVYGTLAANVVL
AGLQLYAAISSGSLSLFATMADAIFDPLSALALILSSRAIKHVDPRRFPAGKARLETVGNIVFCFLMTSVSLIII
ALATQELVQTSSDKKFHLASIISVCAAFSTKFALFLYCWTIKDRYSQVKILWQDHRNDLFVNGFGMLTAVGGARL
EWWIDPAGAIVLSLLVSAVWLHTSCGEFLLLVGVAPSVETQLLLTYVCLTHSPSVRGIETMRAYYSGPRLIVEAD
VVMDQTCTLVETHDLAEELQCKLESLPEVERAYVHVDYETTHKPEHAYMKEI
Coding >Ophio5|223
ATGTCCTCGTTTGGCCGCGGCAGGTCGCCGACCCGTCGCGAGGCCATGACGGCGCCCTTGGAGCGCATCGCCTCG
CAGATGACAGATGTCGAGAGTCAGAAGACGGGCTGCGAGACGCGCACTGACGGACCGAGCGTCGAGAGTGATCCC
TACGACCTCAGGTCCGGCTTCAAGTCCGCATCCGACTTGGCTCGCGTCGACAACAAGTCTATTCGTCAGAATATC
GCCAGGGTTCTCCAGCGCGCTCGTCCGGCTACCAAGGAGATGGCGAGAGGGCCGCGACGCAGCCCCCGCAAGGTG
CGAGGCTTCTATGAGAAACAGAACGAGGCCATCGAGCGGATGCTCAAGCCCGTCGAAGAGCACCGAGCCGACGCC
CGCCGAGAACAGGGCAACGATCAGGTCAGGTACCGCGTTGCCGTTTACGGCACGCTGGCGGCCAACGTCGTGCTG
GCGGGTCTGCAGCTCTATGCGGCCATTTCGTCCGGCTCGTTATCGCTGTTCGCCACCATGGCGGACGCCATTTTC
GATCCCCTCAGCGCCCTGGCGCTCATCCTGTCGAGCCGCGCCATCAAGCACGTCGACCCGCGACGGTTTCCAGCC
GGAAAGGCGCGTCTCGAGACGGTCGGCAATATCGTCTTCTGCTTTCTCATGACGTCAGTCTCGCTCATCATCATC
GCGCTCGCGACGCAGGAGCTCGTGCAAACGAGTTCGGACAAGAAGTTTCACTTGGCGTCCATCATCTCGGTGTGC
GCCGCCTTTTCGACCAAATTTGCGCTCTTTCTGTACTGCTGGACCATCAAGGACAGGTACAGCCAGGTCAAGATT
CTGTGGCAGGACCACCGCAACGACTTGTTCGTCAACGGCTTCGGTATGCTGACGGCGGTGGGCGGCGCGCGGCTG
GAGTGGTGGATCGACCCGGCGGGCGCCATCGTGCTGTCCCTGCTGGTGTCAGCCGTCTGGCTTCACACATCGTGT
GGCGAGTTTCTGCTGCTGGTGGGCGTGGCGCCGTCGGTCGAGACGCAGCTGCTGCTCACGTACGTGTGTCTGACG
CACTCGCCGTCCGTTCGGGGCATTGAAACGATGCGCGCCTATTACTCGGGTCCGCGGCTTATTGTTGAGGCGGAC
GTCGTCATGGACCAGACGTGCACCCTCGTGGAGACGCACGACTTGGCCGAGGAGCTGCAGTGTAAGCTGGAGAGT
CTGCCGGAGGTGGAGCGGGCGTACGTGCATGTCGACTATGAGACGACGCACAAGCCCGAGCACGCGTATATGAAG
GAGATC
Transcript >Ophio5|223
ATGTCCTCGTTTGGCCGCGGCAGGTCGCCGACCCGTCGCGAGGCCATGACGGCGCCCTTGGAGCGCATCGCCTCG
CAGATGACAGATGTCGAGAGTCAGAAGACGGGCTGCGAGACGCGCACTGACGGACCGAGCGTCGAGAGTGATCCC
TACGACCTCAGGTCCGGCTTCAAGTCCGCATCCGACTTGGCTCGCGTCGACAACAAGTCTATTCGTCAGAATATC
GCCAGGGTTCTCCAGCGCGCTCGTCCGGCTACCAAGGAGATGGCGAGAGGGCCGCGACGCAGCCCCCGCAAGGTG
CGAGGCTTCTATGAGAAACAGAACGAGGCCATCGAGCGGATGCTCAAGCCCGTCGAAGAGCACCGAGCCGACGCC
CGCCGAGAACAGGGCAACGATCAGGTCAGGTACCGCGTTGCCGTTTACGGCACGCTGGCGGCCAACGTCGTGCTG
GCGGGTCTGCAGCTCTATGCGGCCATTTCGTCCGGCTCGTTATCGCTGTTCGCCACCATGGCGGACGCCATTTTC
GATCCCCTCAGCGCCCTGGCGCTCATCCTGTCGAGCCGCGCCATCAAGCACGTCGACCCGCGACGGTTTCCAGCC
GGAAAGGCGCGTCTCGAGACGGTCGGCAATATCGTCTTCTGCTTTCTCATGACGTCAGTCTCGCTCATCATCATC
GCGCTCGCGACGCAGGAGCTCGTGCAAACGAGTTCGGACAAGAAGTTTCACTTGGCGTCCATCATCTCGGTGTGC
GCCGCCTTTTCGACCAAATTTGCGCTCTTTCTGTACTGCTGGACCATCAAGGACAGGTACAGCCAGGTCAAGATT
CTGTGGCAGGACCACCGCAACGACTTGTTCGTCAACGGCTTCGGTATGCTGACGGCGGTGGGCGGCGCGCGGCTG
GAGTGGTGGATCGACCCGGCGGGCGCCATCGTGCTGTCCCTGCTGGTGTCAGCCGTCTGGCTTCACACATCGTGT
GGCGAGTTTCTGCTGCTGGTGGGCGTGGCGCCGTCGGTCGAGACGCAGCTGCTGCTCACGTACGTGTGTCTGACG
CACTCGCCGTCCGTTCGGGGCATTGAAACGATGCGCGCCTATTACTCGGGTCCGCGGCTTATTGTTGAGGCGGAC
GTCGTCATGGACCAGACGTGCACCCTCGTGGAGACGCACGACTTGGCCGAGGAGCTGCAGTGTAAGCTGGAGAGT
CTGCCGGAGGTGGAGCGGGCGTACGTGCATGTCGACTATGAGACGACGCACAAGCCCGAGCACGCGTATATGAAG
GAGATCTGA
Gene >Ophio5|223
ATGTCCTCGTTTGGCCGCGGCAGGTCGCCGACCCGTCGCGAGGCCATGACGGCGCCCTTGGAGCGCATCGCCTCG
CAGATGACAGATGTCGAGAGTCAGAAGACGGGCTGCGAGACGCGCACTGACGGACCGAGCGTCGAGAGTGATCCC
TACGACCTCAGGTCCGGCTTCAAGTCCGCATCCGACTTGGCTCGCGTCGACAACAAGTCTATTCGTCAGAATATC
GCCAGGGTTCTCCAGCGCGCTCGTCCGGCTACCAAGGAGATGGCGAGAGGGCCGCGACGCAGCCCCCGCAAGGTG
CGAGGCTTCTATGAGAAACAGAACGAGGCCATCGAGCGGATGCTCAAGCCCGTCGAAGAGCACCGAGCCGACGCC
CGCCGAGAACAGGGCAACGATCAGGTCAGGTACCGCGTTGCCGTTTACGGCACGCTGGCGGCCAACGTCGTGCTG
GCGGGTCTGCAGCTCTATGCGGCCATTTCGTCCGGCTCGTTATCGCTGTTCGCCACCATGGCGGACGCCATTTTC
GATCCCCTCAGCGCCCTGGCGCTCATCCTGTCGAGCCGCGCCATCAAGCACGTCGACCCGCGACGGTTTCCAGCC
GGAAAGGCGCGTCTCGAGACGGTCGGCAATATCGTCTTCTGCTTTCTCATGACGTCAGTCTCGCTCATCATCATC
GCGCTCGCGACGCAGGAGCTCGTGCAAACGAGTTCGGACAAGAAGTTTCACTTGGCGTCCATCATCTCGGTGTGC
GCCGCCTTTTCGACCAAATTTGCGCTCTTTCTGTACTGCTGGACCATCAAGGACAGGTACAGCCAGGTCAAGATT
CTGTGGCAGGACCACCGCAACGACTTGTTCGTCAACGGCTTCGGTATGCTGACGGCGGTGGGCGGCGCGCGGCTG
GAGTGGTGGATCGACCCGGCGGGCGCCATCGTGCTGTCCCTGCTGGTGTCAGCCGTCTGGCTTCACACATCGTGT
GGCGAGTTTCTGCTGCTGGTGGGCGTGGCGCCGTCGGTCGAGACGCAGCTGCTGCTCACGTACGTGTGTCTGACG
CACTCGCCGTCCGTTCGGGGCATTGAAACGATGCGCGCCTATTACTCGGGTCCGCGGCTTATTGTTGAGGCGGAC
GTCGTCATGGACCAGACGTGCACCCTCGTGGAGACGCACGACTTGGCCGAGGAGCTGCAGTGTAAGCTGGAGAGT
CTGCCGGAGGTGGAGCGGGCGTACGTGCATGTCGACTATGAGACGACGCACAAGCCCGAGCACGCGTATATGAAG
GAGATCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail