Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|2227
Gene name
Locationscaffold_191:27529..28811
Strand-
Gene length (bp)1282
Transcript length (bp)1137
Coding sequence length (bp)1134
Protein length (aa) 378

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF10259 Rogdi_lz Rogdi leucine zipper containing protein 2.2E-91 83 368

Swissprot hits

(None)

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm 0.5909 0.3889 0.0667 0.2003 0.1449 0.0275 0.2002 0.4189 0.3188 0.3755

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup4087
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2152
Ophiocordyceps australis map64 (Brazil) OphauB2|5662
Ophiocordyceps camponoti-floridani Ophcf2|02659
Ophiocordyceps camponoti-rufipedis Ophun1|6325
Ophiocordyceps kimflemingae Ophio5|2227 (this protein)
Ophiocordyceps subramaniannii Hirsu2|8244

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|2227
MTAHHVEAARDSSKSGILLLTRTSSPPRLPIALPTLSRRKSPSQDGNGPDRFSAAAMSLVPDLWPPISDSELQRS
KAETLKRELVWITDETIKACRELKHGLDDCYALLAPIDPGSTLVMSTPRNEKVKGTMTRVGSRLVKGSLNLQLRT
TPAFTIYVAPASPIHVHALDDLHTHLSQSIDLLSLTLARDPPHDPPSVASTLALISDSLAESMTLLKGPPLNRPD
ASWQTSSCPPHHFSPPLPANFSFHIGLQESCIVLVLRTLEPVNAPVHLGTKLGLAIGTVRRIEHDEMDLVFRYHP
SGDGTAEPKRGGSRRGLDSAESAASNGAQDVYVREKVRVESADPSLISLQSKLGYLNNMLCQTRRNLATVMAVAD
VDS
Coding >Ophio5|2227
ATGACAGCACATCACGTGGAGGCGGCTAGAGACTCATCTAAGTCCGGCATCCTGCTACTGACACGCACATCATCT
CCTCCACGCCTCCCCATCGCACTGCCCACTCTCTCGCGCAGAAAATCCCCTTCCCAGGACGGGAATGGCCCCGAC
CGCTTCTCAGCCGCCGCAATGTCGCTGGTCCCAGACCTCTGGCCGCCCATCTCCGATTCGGAGTTACAGCGCAGC
AAGGCCGAGACGCTGAAGCGTGAGCTCGTATGGATCACGGACGAAACCATAAAGGCTTGTCGCGAGCTCAAACAC
GGCCTCGACGACTGCTATGCCCTCTTGGCGCCCATCGATCCCGGTAGCACGCTCGTGATGAGCACGCCGCGTAAT
GAAAAGGTCAAGGGCACCATGACGCGCGTCGGAAGCCGCCTCGTCAAAGGCTCGCTCAATCTTCAGCTTCGCACT
ACGCCTGCTTTCACCATCTACGTTGCGCCTGCGTCTCCTATACATGTTCACGCCCTCGACGACCTGCATACTCAT
CTCAGTCAGTCCATCGACCTCCTCTCCTTGACTCTCGCCCGCGACCCGCCCCACGATCCGCCGTCGGTCGCCTCA
ACCCTCGCCCTCATATCCGACTCACTAGCTGAGTCCATGACCCTCCTCAAGGGTCCGCCTCTCAACCGCCCCGAC
GCTTCCTGGCAGACGAGCTCCTGTCCACCCCATCACTTCTCTCCGCCGCTACCCGCCAATTTCAGCTTCCACATC
GGGCTGCAGGAAAGCTGCATCGTCCTCGTACTGCGCACGCTCGAGCCCGTCAACGCCCCCGTGCATCTAGGCACG
AAGCTGGGCCTCGCCATCGGGACCGTGCGCCGCATAGAGCACGACGAGATGGATCTCGTATTTCGGTACCACCCC
TCCGGCGACGGCACAGCCGAACCGAAGAGGGGCGGATCCAGGCGCGGCCTTGACTCGGCCGAATCCGCTGCTAGC
AACGGCGCGCAGGACGTCTACGTGCGGGAAAAGGTGCGCGTCGAGAGCGCTGATCCCAGCCTCATCTCCCTACAG
TCCAAGCTCGGCTACCTCAACAACATGCTTTGCCAAACGAGGAGGAACTTGGCCACTGTCATGGCCGTTGCCGAC
GTAGACAGC
Transcript >Ophio5|2227
ATGACAGCACATCACGTGGAGGCGGCTAGAGACTCATCTAAGTCCGGCATCCTGCTACTGACACGCACATCATCT
CCTCCACGCCTCCCCATCGCACTGCCCACTCTCTCGCGCAGAAAATCCCCTTCCCAGGACGGGAATGGCCCCGAC
CGCTTCTCAGCCGCCGCAATGTCGCTGGTCCCAGACCTCTGGCCGCCCATCTCCGATTCGGAGTTACAGCGCAGC
AAGGCCGAGACGCTGAAGCGTGAGCTCGTATGGATCACGGACGAAACCATAAAGGCTTGTCGCGAGCTCAAACAC
GGCCTCGACGACTGCTATGCCCTCTTGGCGCCCATCGATCCCGGTAGCACGCTCGTGATGAGCACGCCGCGTAAT
GAAAAGGTCAAGGGCACCATGACGCGCGTCGGAAGCCGCCTCGTCAAAGGCTCGCTCAATCTTCAGCTTCGCACT
ACGCCTGCTTTCACCATCTACGTTGCGCCTGCGTCTCCTATACATGTTCACGCCCTCGACGACCTGCATACTCAT
CTCAGTCAGTCCATCGACCTCCTCTCCTTGACTCTCGCCCGCGACCCGCCCCACGATCCGCCGTCGGTCGCCTCA
ACCCTCGCCCTCATATCCGACTCACTAGCTGAGTCCATGACCCTCCTCAAGGGTCCGCCTCTCAACCGCCCCGAC
GCTTCCTGGCAGACGAGCTCCTGTCCACCCCATCACTTCTCTCCGCCGCTACCCGCCAATTTCAGCTTCCACATC
GGGCTGCAGGAAAGCTGCATCGTCCTCGTACTGCGCACGCTCGAGCCCGTCAACGCCCCCGTGCATCTAGGCACG
AAGCTGGGCCTCGCCATCGGGACCGTGCGCCGCATAGAGCACGACGAGATGGATCTCGTATTTCGGTACCACCCC
TCCGGCGACGGCACAGCCGAACCGAAGAGGGGCGGATCCAGGCGCGGCCTTGACTCGGCCGAATCCGCTGCTAGC
AACGGCGCGCAGGACGTCTACGTGCGGGAAAAGGTGCGCGTCGAGAGCGCTGATCCCAGCCTCATCTCCCTACAG
TCCAAGCTCGGCTACCTCAACAACATGCTTTGCCAAACGAGGAGGAACTTGGCCACTGTCATGGCCGTTGCCGAC
GTAGACAGCTGA
Gene >Ophio5|2227
ATGACAGCACATCACGTGGAGGCGGCTAGAGACTCATCTAAGTCCGGCATCCTGCTACTGACACGCACATCATCT
CCTCCACGCCTCCCCATCGCACTGCCCACTCTCTCGCGCAGAAAATCCCCTTCCCAGGACGGGAATGGCCCCGAC
CGCTTCTCAGCCGCCGCAATGTCGCTGGTCCCAGACCTCTGGCCGCCCATCTCCGATTCGGAGTTACAGCGCAGC
AAGGCCGAGACGCTGGTCCGTGAAGCCCTTTCCCCCCTTTCGTCTTCTTCTTCTTTACTGACGAGCGGCTTTCCT
ACGACAAGAAGCGTGAGCTCGTATGGATCACGGACGAAACCATAAAGGCTTGTCGCGAGCTCAAACACGGCCTCG
ACGACTGCTATGCCCTCTTGGCGCCCATCGATCCCGGTAGCACGCTCGTGATGAGCACGCCGCGTAATGAAAAGG
TCAAGGGCACCATGACGCGCGTCGGAAGCCGCCTCGTCAAAGGCGTGCGTCGTCCTCTCGGCTGAAGTTTTTGTC
GCTACTGCCTCTTGGCTGACTGCGCTTGGATCCTTTTTGCCTGCAGTCGCTCAATCTTCAGCTTCGCACTACGCC
TGCTTTCACCATCTACGTTGCGCCTGCGTCTCCTATACATGTTCACGCCCTCGACGACCTGCATACTCATCTCAG
TCAGTCCATCGACCTCCTCTCCTTGACTCTCGCCCGCGACCCGCCCCACGATCCGCCGTCGGTCGCCTCAACCCT
CGCCCTCATATCCGACTCACTAGCTGAGTCCATGACCCTCCTCAAGGGTCCGCCTCTCAACCGCCCCGACGCTTC
CTGGCAGACGAGCTCCTGTCCACCCCATCACTTCTCTCCGCCGCTACCCGCCAATTTCAGCTTCCACATCGGGCT
GCAGGAAAGCTGCATCGTCCTCGTACTGCGCACGCTCGAGCCCGTCAACGCCCCCGTGCATCTAGGCACGAAGCT
GGGCCTCGCCATCGGGACCGTGCGCCGCATAGAGCACGACGAGATGGATCTCGTATTTCGGTACCACCCCTCCGG
CGACGGCACAGCCGAACCGAAGAGGGGCGGATCCAGGCGCGGCCTTGACTCGGCCGAATCCGCTGCTAGCAACGG
CGCGCAGGACGTCTACGTGCGGGAAAAGGTGCGCGTCGAGAGCGCTGATCCCAGCCTCATCTCCCTACAGTCCAA
GCTCGGCTACCTCAACAACATGCTTTGCCAAACGAGGAGGAACTTGGCCACTGTCATGGCCGTTGCCGACGTAGA
CAGCTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail