Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|2220
Gene name
Locationscaffold_191:14967..16016
Strand+
Gene length (bp)1049
Transcript length (bp)924
Coding sequence length (bp)921
Protein length (aa) 307

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

Domain # Start End Length
1 131 153 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
SC16a Pure fungal culture 7.57 2.11 13.02
CcL In ants, during behavior modification 5.03 1.14 8.91
CcD In ants, recently dead 3.18 0.39 5.98

Differential expression

Label1 Label2 Q-value Significant difference
SC16a CcL 0.295748 no
SC16a CcD 0.034925 yes
CcL CcD 0.302593 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|2220
MAVHPTDAAAQGMAIHGLRFINDEWNDSISNGDVFTVRWNQSLSKVGSGLGVFQVTYPKDGVVVYELVSNLTDAI
EGDGASCKWTPQNLDKKGLYAMWLTSGQANHPNWTLSPPWVPKAGAGSQSSPWAAPFLIPVICLLGLYAISLTGY
LVYRRRKKARMERAMANSNAIRGRSFSVTSPITAHVLAGPETGIEKSGVVGMVNASPIISRDSRLSSSGIRRSRT
AQPDDDDDDDDDDDDDDDRLRLPRHPRGRGIRIVTTGGPSSEAEERLLMTPVHSAGSTTSSAQQTPVGRNFSRPV
QTQRSFA
Coding >Ophio5|2220
ATGGCCGTTCATCCAACAGACGCCGCCGCTCAGGGCATGGCCATCCACGGCCTTCGCTTCATCAACGATGAGTGG
AACGACAGCATCTCTAACGGCGACGTCTTCACCGTCCGATGGAACCAGTCTCTGTCCAAAGTCGGCTCCGGCCTG
GGTGTGTTCCAAGTAACGTATCCGAAGGACGGCGTCGTCGTCTACGAGCTGGTATCGAATCTAACTGATGCCATC
GAGGGCGACGGCGCCTCGTGTAAATGGACGCCGCAGAATCTGGACAAGAAGGGCCTCTATGCCATGTGGCTCACG
TCTGGACAAGCCAATCATCCCAATTGGACTCTGTCGCCTCCTTGGGTCCCCAAAGCAGGGGCCGGATCGCAGAGC
TCCCCGTGGGCGGCGCCCTTTCTCATCCCCGTCATATGTCTGCTCGGCCTCTACGCCATCTCTTTGACAGGCTAC
CTGGTCTATCGCCGTCGGAAAAAGGCCAGGATGGAGAGGGCCATGGCGAATTCCAACGCCATTCGCGGTCGCAGC
TTCTCCGTCACTTCGCCCATCACGGCGCATGTTCTCGCTGGACCCGAGACCGGCATCGAGAAGAGCGGCGTCGTC
GGCATGGTCAACGCTAGCCCGATCATCAGTAGAGACAGCCGTCTCAGCTCGTCCGGAATCCGTCGCTCAAGGACA
GCTCAACCCGACGATGATGATGATGATGACGACGACGACGACGACGACGACGACAGGCTCCGGCTTCCCCGGCAC
CCAAGAGGTCGCGGAATCCGCATCGTCACCACCGGTGGCCCGAGCTCTGAAGCCGAGGAAAGGCTTTTGATGACG
CCCGTCCATAGCGCCGGATCAACAACGTCCAGCGCGCAACAAACTCCCGTCGGCCGCAACTTTTCCCGGCCTGTA
CAAACACAAAGAAGCTTTGCA
Transcript >Ophio5|2220
ATGGCCGTTCATCCAACAGACGCCGCCGCTCAGGGCATGGCCATCCACGGCCTTCGCTTCATCAACGATGAGTGG
AACGACAGCATCTCTAACGGCGACGTCTTCACCGTCCGATGGAACCAGTCTCTGTCCAAAGTCGGCTCCGGCCTG
GGTGTGTTCCAAGTAACGTATCCGAAGGACGGCGTCGTCGTCTACGAGCTGGTATCGAATCTAACTGATGCCATC
GAGGGCGACGGCGCCTCGTGTAAATGGACGCCGCAGAATCTGGACAAGAAGGGCCTCTATGCCATGTGGCTCACG
TCTGGACAAGCCAATCATCCCAATTGGACTCTGTCGCCTCCTTGGGTCCCCAAAGCAGGGGCCGGATCGCAGAGC
TCCCCGTGGGCGGCGCCCTTTCTCATCCCCGTCATATGTCTGCTCGGCCTCTACGCCATCTCTTTGACAGGCTAC
CTGGTCTATCGCCGTCGGAAAAAGGCCAGGATGGAGAGGGCCATGGCGAATTCCAACGCCATTCGCGGTCGCAGC
TTCTCCGTCACTTCGCCCATCACGGCGCATGTTCTCGCTGGACCCGAGACCGGCATCGAGAAGAGCGGCGTCGTC
GGCATGGTCAACGCTAGCCCGATCATCAGTAGAGACAGCCGTCTCAGCTCGTCCGGAATCCGTCGCTCAAGGACA
GCTCAACCCGACGATGATGATGATGATGACGACGACGACGACGACGACGACGACAGGCTCCGGCTTCCCCGGCAC
CCAAGAGGTCGCGGAATCCGCATCGTCACCACCGGTGGCCCGAGCTCTGAAGCCGAGGAAAGGCTTTTGATGACG
CCCGTCCATAGCGCCGGATCAACAACGTCCAGCGCGCAACAAACTCCCGTCGGCCGCAACTTTTCCCGGCCTGTA
CAAACACAAAGAAGCTTTGCATAA
Gene >Ophio5|2220
ATGGCCGTTCATCCAACAGACGCCGCCGCTCAGGGCATGGCCATCCACGGCCTTCGCTTCATCAACGATGAGTGG
AACGACAGCATCTCTAACGGCGACGTCTTCACCGTCCGATGGAACCAGTCTCTGTCCAAAGTCGGCTCCGGCCTG
GGTGTGTTCCAAGTAACGTATCCGAAGGACGGCGTCGTCGTCTACGAGCTGGTATCGAATCTAACTGGTCTGTAG
CCCGCCGTGCTGCTTTTGTACCCTTCACCTCACTGACCGAGTGACGTGATAGATGCCATCGAGGGCGACGGCGCC
TCGTGTAAATGGACGCCGCAGAATCTGGACAAGAAGGGCCTCTATGCCATGTGGCTCACGTCTGGACAAGCCAAT
CATCCCAATTGGACTCTGTCGCCTCCTTGGGTCCCCAAAGCAGGGGTTGGTTCCCCTTCCCCGTCTCCCCTCGTT
CTGAGTGTCCGTCTAATCAAGACGTCAATTTCAAGGCCGGATCGCAGAGCTCCCCGTGGGCGGCGCCCTTTCTCA
TCCCCGTCATATGTCTGCTCGGCCTCTACGCCATCTCTTTGACAGGCTACCTGGTCTATCGCCGTCGGAAAAAGG
CCAGGATGGAGAGGGCCATGGCGAATTCCAACGCCATTCGCGGTCGCAGCTTCTCCGTCACTTCGCCCATCACGG
CGCATGTTCTCGCTGGACCCGAGACCGGCATCGAGAAGAGCGGCGTCGTCGGCATGGTCAACGCTAGCCCGATCA
TCAGTAGAGACAGCCGTCTCAGCTCGTCCGGAATCCGTCGCTCAAGGACAGCTCAACCCGACGATGATGATGATG
ATGACGACGACGACGACGACGACGACGACAGGCTCCGGCTTCCCCGGCACCCAAGAGGTCGCGGAATCCGCATCG
TCACCACCGGTGGCCCGAGCTCTGAAGCCGAGGAAAGGCTTTTGATGACGCCCGTCCATAGCGCCGGATCAACAA
CGTCCAGCGCGCAACAAACTCCCGTCGGCCGCAACTTTTCCCGGCCTGTACAAACACAAAGAAGCTTTGCATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail