Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|2216
Gene name
Locationscaffold_191:5058..6886
Strand-
Gene length (bp)1828
Transcript length (bp)1578
Coding sequence length (bp)1575
Protein length (aa) 525

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01490 Aa_trans Transmembrane amino acid transporter protein 7.6E-93 39 436

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P40074|AVT6_YEAST Vacuolar amino acid transporter 6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AVT6 PE=1 SV=1 40 428 8.0E-98
sp|O74327|AVT5_SCHPO Vacuolar amino acid transporter 5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=avt5 PE=3 SV=1 38 519 1.0E-88
sp|P38176|AVT5_YEAST Vacuolar amino acid transporter 5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AVT5 PE=3 SV=2 44 428 1.0E-82
sp|P40501|AVT7_YEAST Vacuolar amino acid transporter 7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AVT7 PE=1 SV=1 40 440 3.0E-76
sp|Q6JWR2|S38A7_RAT Putative sodium-coupled neutral amino acid transporter 7 OS=Rattus norvegicus GN=Slc38a7 PE=2 SV=1 38 431 2.0E-25
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P40074|AVT6_YEAST Vacuolar amino acid transporter 6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AVT6 PE=1 SV=1 40 428 8.0E-98
sp|O74327|AVT5_SCHPO Vacuolar amino acid transporter 5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=avt5 PE=3 SV=1 38 519 1.0E-88
sp|P38176|AVT5_YEAST Vacuolar amino acid transporter 5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AVT5 PE=3 SV=2 44 428 1.0E-82
sp|P40501|AVT7_YEAST Vacuolar amino acid transporter 7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AVT7 PE=1 SV=1 40 440 3.0E-76
sp|Q6JWR2|S38A7_RAT Putative sodium-coupled neutral amino acid transporter 7 OS=Rattus norvegicus GN=Slc38a7 PE=2 SV=1 38 431 2.0E-25
sp|Q8BWH0|S38A7_MOUSE Putative sodium-coupled neutral amino acid transporter 7 OS=Mus musculus GN=Slc38a7 PE=1 SV=1 38 431 3.0E-25
sp|Q5SPB1|S38A2_DANRE Sodium-coupled neutral amino acid transporter 2 OS=Danio rerio GN=slc38a2 PE=3 SV=1 38 430 5.0E-24
sp|Q6DEL1|S38A7_DANRE Putative sodium-coupled neutral amino acid transporter 7 OS=Danio rerio GN=slc38a7 PE=2 SV=1 38 419 6.0E-24
sp|Q9NVC3|S38A7_HUMAN Putative sodium-coupled neutral amino acid transporter 7 OS=Homo sapiens GN=SLC38A7 PE=1 SV=1 22 431 2.0E-23
sp|Q5R9F5|S38A7_PONAB Putative sodium-coupled neutral amino acid transporter 7 OS=Pongo abelii GN=SLC38A7 PE=2 SV=1 30 431 2.0E-23
sp|A7E3U5|S38A7_BOVIN Putative sodium-coupled neutral amino acid transporter 7 OS=Bos taurus GN=SLC38A7 PE=2 SV=1 45 431 4.0E-22
sp|Q5XH90|S38A2_XENTR Sodium-coupled neutral amino acid transporter 2 OS=Xenopus tropicalis GN=slc38a2 PE=2 SV=1 28 430 1.0E-21
sp|Q9JHZ9|S38A3_RAT Sodium-coupled neutral amino acid transporter 3 OS=Rattus norvegicus GN=Slc38a3 PE=2 SV=1 11 429 7.0E-20
sp|E9PT23|S38AA_RAT Putative sodium-coupled neutral amino acid transporter 10 OS=Rattus norvegicus GN=Slc38a10 PE=2 SV=2 46 423 8.0E-20
sp|Q28HE5|S38A6_XENTR Probable sodium-coupled neutral amino acid transporter 6 OS=Xenopus tropicalis GN=slc38a6 PE=2 SV=1 25 435 1.0E-19
sp|Q5R443|S38A1_PONAB Sodium-coupled neutral amino acid transporter 1 OS=Pongo abelii GN=SLC38A1 PE=2 SV=1 21 428 1.0E-19
sp|Q9EQ25|S38A4_RAT Sodium-coupled neutral amino acid transporter 4 OS=Rattus norvegicus GN=Slc38a4 PE=1 SV=1 38 436 2.0E-19
sp|Q9H2H9|S38A1_HUMAN Sodium-coupled neutral amino acid transporter 1 OS=Homo sapiens GN=SLC38A1 PE=1 SV=1 21 428 2.0E-19
sp|Q8R1S9|S38A4_MOUSE Sodium-coupled neutral amino acid transporter 4 OS=Mus musculus GN=Slc38a4 PE=1 SV=1 38 436 4.0E-19
sp|Q9DCP2|S38A3_MOUSE Sodium-coupled neutral amino acid transporter 3 OS=Mus musculus GN=Slc38a3 PE=1 SV=1 4 428 5.0E-19
sp|Q8K2P7|S38A1_MOUSE Sodium-coupled neutral amino acid transporter 1 OS=Mus musculus GN=Slc38a1 PE=1 SV=1 21 337 1.0E-18
sp|Q9JM15|S38A1_RAT Sodium-coupled neutral amino acid transporter 1 OS=Rattus norvegicus GN=Slc38a1 PE=1 SV=1 21 428 2.0E-18
sp|Q6DFE7|S38A7_XENLA Putative sodium-coupled neutral amino acid transporter 7 OS=Xenopus laevis GN=slc38a7 PE=2 SV=1 36 433 2.0E-18
sp|Q5I012|S38AA_MOUSE Putative sodium-coupled neutral amino acid transporter 10 OS=Mus musculus GN=Slc38a10 PE=1 SV=2 46 423 4.0E-18
sp|Q6WWW3|S38A6_RAT Probable sodium-coupled neutral amino acid transporter 6 OS=Rattus norvegicus GN=Slc38a6 PE=2 SV=1 10 435 4.0E-18
sp|Q99624|S38A3_HUMAN Sodium-coupled neutral amino acid transporter 3 OS=Homo sapiens GN=SLC38A3 PE=1 SV=1 19 429 4.0E-18
sp|Q5E9S9|S38A5_BOVIN Sodium-coupled neutral amino acid transporter 5 OS=Bos taurus GN=SLC38A5 PE=2 SV=1 28 428 6.0E-18
sp|G3UVW3|S38A6_MOUSE Probable sodium-coupled neutral amino acid transporter 6 OS=Mus musculus GN=Slc38a6 PE=2 SV=1 10 435 1.0E-17
sp|A1YG32|S38A2_PANPA Sodium-coupled neutral amino acid transporter 2 OS=Pan paniscus GN=SLC38A2 PE=3 SV=1 38 428 2.0E-17
sp|D3Z813|S38AB_RAT Putative sodium-coupled neutral amino acid transporter 11 OS=Rattus norvegicus GN=Slc38a11 PE=2 SV=1 37 436 2.0E-17
sp|Q3U1J0|S38A5_MOUSE Sodium-coupled neutral amino acid transporter 5 OS=Mus musculus GN=Slc38a5 PE=1 SV=1 26 428 2.0E-17
sp|Q5RC98|S38AA_PONAB Putative sodium-coupled neutral amino acid transporter 10 OS=Pongo abelii GN=SLC38A10 PE=2 SV=1 40 424 3.0E-17
sp|Q96QD8|S38A2_HUMAN Sodium-coupled neutral amino acid transporter 2 OS=Homo sapiens GN=SLC38A2 PE=1 SV=2 38 428 3.0E-17
sp|Q5F468|S38A2_CHICK Sodium-coupled neutral amino acid transporter 2 OS=Gallus gallus GN=SLC38A2 PE=2 SV=2 6 428 4.0E-17
sp|Q8WUX1|S38A5_HUMAN Sodium-coupled neutral amino acid transporter 5 OS=Homo sapiens GN=SLC38A5 PE=1 SV=1 38 428 4.0E-17
sp|Q9HBR0|S38AA_HUMAN Putative sodium-coupled neutral amino acid transporter 10 OS=Homo sapiens GN=SLC38A10 PE=1 SV=2 40 424 4.0E-17
sp|A2VCW5|S38A5_RAT Sodium-coupled neutral amino acid transporter 5 OS=Rattus norvegicus GN=Slc38a5 PE=1 SV=1 13 424 5.0E-17
sp|Q8IZM9|S38A6_HUMAN Probable sodium-coupled neutral amino acid transporter 6 OS=Homo sapiens GN=SLC38A6 PE=1 SV=2 20 435 2.0E-16
sp|Q9JHE5|S38A2_RAT Sodium-coupled neutral amino acid transporter 2 OS=Rattus norvegicus GN=Slc38a2 PE=1 SV=1 38 428 3.0E-16
sp|Q3USY0|S38AB_MOUSE Putative sodium-coupled neutral amino acid transporter 11 OS=Mus musculus GN=Slc38a11 PE=2 SV=2 37 436 9.0E-16
sp|A2VE31|S38A2_BOVIN Sodium-coupled neutral amino acid transporter 2 OS=Bos taurus GN=SLC38A2 PE=2 SV=1 38 428 6.0E-14
sp|Q503G8|S38A6_DANRE Probable sodium-coupled neutral amino acid transporter 6 OS=Danio rerio GN=slc38a6 PE=2 SV=1 40 426 6.0E-14
sp|Q6PCF9|S38AA_XENLA Putative sodium-coupled neutral amino acid transporter 10 OS=Xenopus laevis GN=slc38a10 PE=2 SV=1 40 424 4.0E-13
sp|Q5RE87|S38A4_PONAB Sodium-coupled neutral amino acid transporter 4 OS=Pongo abelii GN=SLC38A4 PE=2 SV=1 211 429 4.0E-13
sp|Q969I6|S38A4_HUMAN Sodium-coupled neutral amino acid transporter 4 OS=Homo sapiens GN=SLC38A4 PE=1 SV=1 211 429 4.0E-13
sp|P39981|AVT2_YEAST Vacuolar amino acid transporter 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AVT2 PE=2 SV=1 39 417 2.0E-12
sp|Q8CFE6|S38A2_MOUSE Sodium-coupled neutral amino acid transporter 2 OS=Mus musculus GN=Slc38a2 PE=1 SV=1 38 428 4.0E-12
sp|Q5HZH7|S38A8_MOUSE Putative sodium-coupled neutral amino acid transporter 8 OS=Mus musculus GN=Slc38a8 PE=2 SV=1 41 430 6.0E-12
sp|Q5EA97|S38AB_BOVIN Putative sodium-coupled neutral amino acid transporter 11 OS=Bos taurus GN=SLC38A11 PE=2 SV=1 9 300 9.0E-12
sp|Q28I47|S38A8_XENTR Putative sodium-coupled neutral amino acid transporter 8 OS=Xenopus tropicalis GN=slc38a8 PE=2 SV=1 31 301 6.0E-10
sp|Q8CH36|S36A4_MOUSE Proton-coupled amino acid transporter 4 OS=Mus musculus GN=Slc36a4 PE=2 SV=1 32 419 1.0E-09
sp|A6NNN8|S38A8_HUMAN Putative sodium-coupled neutral amino acid transporter 8 OS=Homo sapiens GN=SLC38A8 PE=1 SV=1 41 419 2.0E-09
sp|Q4KL91|S36A4_XENLA Proton-coupled amino acid transporter 4 OS=Xenopus laevis GN=slc36a4 PE=2 SV=1 11 419 4.0E-09
sp|Q6YBV0|S36A4_HUMAN Proton-coupled amino acid transporter 4 OS=Homo sapiens GN=SLC36A4 PE=1 SV=1 41 304 5.0E-09
sp|A8KBL5|S38AB_DANRE Putative sodium-coupled neutral amino acid transporter 11 OS=Danio rerio GN=slc38a11 PE=2 SV=2 22 436 2.0E-08
sp|P34579|UNC47_CAEEL Vesicular GABA transporter OS=Caenorhabditis elegans GN=unc-47 PE=1 SV=2 26 426 3.0E-08
sp|Q7Z2H8|S36A1_HUMAN Proton-coupled amino acid transporter 1 OS=Homo sapiens GN=SLC36A1 PE=1 SV=1 35 436 4.0E-07
sp|Q10074|AVT3_SCHPO Vacuolar amino acid transporter 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=avt3 PE=1 SV=1 38 341 6.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 16 0.5

Transmembrane Domains

Domain # Start End Length
1 36 58 22
2 68 90 22
3 117 139 22
4 159 181 22
5 188 210 22
6 230 252 22
7 265 287 22
8 297 319 22
9 376 395 19
10 400 422 22
11 502 524 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|2216
MAMTTYSTIPEATHASAGGARDMSRTRRRGGKDGGLGGQASTLSSIVNLLNTIVGAGTLAMPSVLSHMGIMLGVV
LILWSGITAAFGLYLQSRCARYLDRGTSSFFALSQITYPNASVIFDLAIAVKCFGVAVSYMIIIGDLMPGVMLGF
NDAVADIPYLVDRHFWITAFMLLIIPLSFLRRLDSLKYTSLVALVSIGYLIVLVIYHFAADAHADPEDIRVIQWA
GPVETLSALPVVVFAYTCHQNMFSIINEIKDNSPASMVEVVTSSIGSAACIYVLVAITGYITFGNSIVGNIVSMY
PTSVASTIGKAAIVLLVLFSIPLQIHPCRASLHAVLKWRPNRSSANAGRPGSPLLNASAVPRGDHGGGTPISDTR
FALLTTLILTLAYTTALSVSSLDRVLAFVGSTGSTSISFILPGLFYYKISDPESIHHQRLIKGDDDMDDEPSSDV
EEAAGGILTQSTSSIRSGTGAGGSQPRWRWRRKWRWDLEHLDHQLTRKLALSLAAYGIVVMTVCLLMNIFFAVAH
Coding >Ophio5|2216
ATGGCTATGACGACCTACTCGACCATTCCGGAGGCCACCCACGCCTCTGCCGGAGGCGCCCGCGATATGTCGAGG
ACTCGACGACGAGGCGGCAAGGATGGCGGCCTTGGCGGCCAGGCCTCGACGCTCAGCAGCATCGTCAATCTGCTC
AATACCATTGTCGGCGCCGGCACCCTGGCCATGCCCTCGGTTCTCTCTCATATGGGCATCATGCTGGGCGTCGTT
CTCATTCTCTGGTCTGGCATCACAGCCGCCTTCGGCCTGTATCTGCAATCCCGCTGCGCCCGCTACCTCGATCGC
GGCACGTCGTCCTTCTTCGCCCTGTCGCAAATCACATATCCGAATGCTTCGGTCATATTCGACCTGGCAATCGCC
GTCAAGTGCTTTGGCGTGGCCGTCTCGTACATGATCATCATCGGTGATCTCATGCCAGGCGTCATGCTCGGCTTC
AACGACGCCGTCGCCGACATTCCGTATTTGGTCGACCGTCATTTCTGGATCACGGCTTTTATGCTCCTCATCATA
CCCTTAAGCTTCTTGCGCAGGCTGGACTCGCTCAAGTACACCAGCCTCGTCGCCTTGGTTTCTATCGGCTATCTC
ATTGTCCTCGTCATTTACCACTTCGCCGCCGACGCCCACGCAGACCCCGAGGACATCCGCGTGATACAATGGGCT
GGCCCGGTCGAGACGCTCAGCGCGCTGCCTGTCGTCGTCTTCGCCTATACGTGCCATCAGAATATGTTCTCCATC
ATCAACGAGATCAAAGATAACTCACCGGCGAGCATGGTCGAGGTGGTGACTTCTAGTATCGGGTCCGCCGCCTGC
ATCTACGTCCTCGTCGCCATCACAGGGTACATTACCTTTGGCAACTCCATCGTCGGCAACATTGTTTCTATGTAT
CCAACGAGCGTCGCATCCACCATTGGCAAGGCCGCCATTGTTCTCCTTGTGTTGTTCTCTATCCCCTTGCAAATC
CATCCCTGCCGCGCATCGTTGCACGCCGTACTCAAGTGGCGACCGAACCGGTCGAGCGCCAATGCTGGTCGCCCA
GGGTCTCCTCTCCTCAACGCGTCTGCCGTGCCGCGTGGCGACCATGGAGGCGGCACGCCCATCTCCGACACGCGA
TTCGCCCTCCTCACCACCCTCATCCTGACACTGGCGTACACGACGGCACTGTCGGTGAGCAGTCTCGACCGCGTC
CTAGCCTTCGTCGGCAGCACGGGCTCGACATCCATCAGCTTCATCCTACCCGGCCTGTTCTACTACAAGATTAGC
GATCCGGAGAGCATCCACCACCAGCGCCTGATCAAGGGTGACGACGACATGGACGACGAGCCCTCCTCCGACGTC
GAGGAGGCCGCCGGCGGCATCCTGACGCAGAGCACGTCCAGCATACGCAGCGGCACCGGCGCCGGCGGCTCCCAG
CCGCGCTGGCGATGGCGGAGGAAGTGGCGATGGGATCTGGAGCATCTCGATCACCAGCTGACGAGGAAGCTTGCG
CTCTCGCTCGCGGCATACGGCATCGTCGTCATGACGGTATGTCTCCTTATGAACATCTTCTTTGCTGTCGCTCAT
Transcript >Ophio5|2216
ATGGCTATGACGACCTACTCGACCATTCCGGAGGCCACCCACGCCTCTGCCGGAGGCGCCCGCGATATGTCGAGG
ACTCGACGACGAGGCGGCAAGGATGGCGGCCTTGGCGGCCAGGCCTCGACGCTCAGCAGCATCGTCAATCTGCTC
AATACCATTGTCGGCGCCGGCACCCTGGCCATGCCCTCGGTTCTCTCTCATATGGGCATCATGCTGGGCGTCGTT
CTCATTCTCTGGTCTGGCATCACAGCCGCCTTCGGCCTGTATCTGCAATCCCGCTGCGCCCGCTACCTCGATCGC
GGCACGTCGTCCTTCTTCGCCCTGTCGCAAATCACATATCCGAATGCTTCGGTCATATTCGACCTGGCAATCGCC
GTCAAGTGCTTTGGCGTGGCCGTCTCGTACATGATCATCATCGGTGATCTCATGCCAGGCGTCATGCTCGGCTTC
AACGACGCCGTCGCCGACATTCCGTATTTGGTCGACCGTCATTTCTGGATCACGGCTTTTATGCTCCTCATCATA
CCCTTAAGCTTCTTGCGCAGGCTGGACTCGCTCAAGTACACCAGCCTCGTCGCCTTGGTTTCTATCGGCTATCTC
ATTGTCCTCGTCATTTACCACTTCGCCGCCGACGCCCACGCAGACCCCGAGGACATCCGCGTGATACAATGGGCT
GGCCCGGTCGAGACGCTCAGCGCGCTGCCTGTCGTCGTCTTCGCCTATACGTGCCATCAGAATATGTTCTCCATC
ATCAACGAGATCAAAGATAACTCACCGGCGAGCATGGTCGAGGTGGTGACTTCTAGTATCGGGTCCGCCGCCTGC
ATCTACGTCCTCGTCGCCATCACAGGGTACATTACCTTTGGCAACTCCATCGTCGGCAACATTGTTTCTATGTAT
CCAACGAGCGTCGCATCCACCATTGGCAAGGCCGCCATTGTTCTCCTTGTGTTGTTCTCTATCCCCTTGCAAATC
CATCCCTGCCGCGCATCGTTGCACGCCGTACTCAAGTGGCGACCGAACCGGTCGAGCGCCAATGCTGGTCGCCCA
GGGTCTCCTCTCCTCAACGCGTCTGCCGTGCCGCGTGGCGACCATGGAGGCGGCACGCCCATCTCCGACACGCGA
TTCGCCCTCCTCACCACCCTCATCCTGACACTGGCGTACACGACGGCACTGTCGGTGAGCAGTCTCGACCGCGTC
CTAGCCTTCGTCGGCAGCACGGGCTCGACATCCATCAGCTTCATCCTACCCGGCCTGTTCTACTACAAGATTAGC
GATCCGGAGAGCATCCACCACCAGCGCCTGATCAAGGGTGACGACGACATGGACGACGAGCCCTCCTCCGACGTC
GAGGAGGCCGCCGGCGGCATCCTGACGCAGAGCACGTCCAGCATACGCAGCGGCACCGGCGCCGGCGGCTCCCAG
CCGCGCTGGCGATGGCGGAGGAAGTGGCGATGGGATCTGGAGCATCTCGATCACCAGCTGACGAGGAAGCTTGCG
CTCTCGCTCGCGGCATACGGCATCGTCGTCATGACGGTATGTCTCCTTATGAACATCTTCTTTGCTGTCGCTCAT
TAG
Gene >Ophio5|2216
ATGGCTATGACGACCTACTCGACCATTCCGGAGGCCACCCACGCCTCTGCCGGAGGCGCCCGCGATATGTCGAGG
TGTGTCGTCGTCATCATCATTGTCGTCGCTCGCGCTGGATTGAGGCGATGGGATACTGACTTGTTCCCCTTTAAA
GGACTCGACGACGAGGCGGCAAGGATGGCGGCCTTGGCGGCCAGGCCTCGACGCTCAGCAGCATCGTCAATCTGC
TCAATACCAGTGCGCTCCCCAACCCTCCCCACCATCTTCGGCCCACCGGCTGACGCTCGCAGTTGTCGGCGCCGG
CACCCTGGCCATGCCCTCGGTTCTCTCTCATATGGGCATCATGCTGGGCGTCGTTCTCATTCTCTGGTCTGGCAT
CACAGCCGCCTTCGGCCTGTATCTGCAATCCCGCTGCGCCCGCTACCTCGATCGCGGCACGTCGTCCTTCTTCGC
CCTGTCGCAAATCACATATCCGAATGCTTCGGTCATATTCGACCTGGCAATCGCCGTCAAGTGCTTTGGCGTGGC
CGTCTCGTACATGATCATCATCGGTGATCTCATGCCAGGCGTCATGCTCGGCTTCAACGACGCCGTCGCCGACAT
TCCGTATTTGGTCGACCGTCATTTCTGGATCACGGCTTTTATGCTCCTCATCATACCCTTAAGCTTCTTGCGCAG
GCTGGACTCGCTCAAGTACACCAGCCTCGTCGCCTTGGTTTCTATCGGCTATCTCATTGTCCTCGTCATTTACCA
CTTCGCCGCCGACGCCCACGCAGACCCCGAGGACATCCGCGTGATACAATGGGCTGGCCCGGTCGAGACGCTCAG
CGCGCTGCCTGTCGTCGTCTTCGCCTATACGTGCCATCAGAATGCGAGTTCCCCCGAGCTGGTCCTGCGGAGCGC
TAGCTGACAGTCGGGGCTGAACAGATGTTCTCCATCATCAACGAGATCAAAGATAACTCACCGGCGAGCATGGTC
GAGGTGGTGACTTCTAGTATCGGGTCCGCCGCCTGCATCTACGTCCTCGTCGCCATCACAGGGTACATTACCTTT
GGCAACTCCATCGTCGGCAACATTGTTTCTATGTGTGAGGCAACCCCCCCTCTCCCTCCTCGCGTGGCGTCGCGC
ATGACCTGACGTGGCGAGTCCAGATCCAACGAGCGTCGCATCCACCATTGGCAAGGCCGCCATTGTTCTCCTTGT
GTTGTTCTCTATCCCCTTGCAAATCCATCCCTGCCGCGCATCGTTGCACGCCGTACTCAAGTGGCGACCGAACCG
GTCGAGCGCCAATGCTGGTCGCCCAGGGTCTCCTCTCCTCAACGCGTCTGCCGTGCCGCGTGGCGACCATGGAGG
CGGCACGCCCATCTCCGACACGCGATTCGCCCTCCTCACCACCCTCATCCTGACACTGGCGTACACGACGGCACT
GTCGGTGAGCAGTCTCGACCGCGTCCTAGCCTTCGTCGGCAGCACGGGCTCGACATCCATCAGCTTCATCCTACC
CGGCCTGTTCTACTACAAGATTAGCGATCCGGAGAGCATCCACCACCAGCGCCTGATCAAGGGTGACGACGACAT
GGACGACGAGCCCTCCTCCGACGTCGAGGAGGCCGCCGGCGGCATCCTGACGCAGAGCACGTCCAGCATACGCAG
CGGCACCGGCGCCGGCGGCTCCCAGCCGCGCTGGCGATGGCGGAGGAAGTGGCGATGGGATCTGGAGCATCTCGA
TCACCAGCTGACGAGGAAGCTTGCGCTCTCGCTCGCGGCATACGGCATCGTCGTCATGACGGTATGTCTCCTTAT
GAACATCTTCTTTGCTGTCGCTCATTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail