Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|2214
Gene name
Locationscaffold_191:1725..2640
Strand-
Gene length (bp)915
Transcript length (bp)537
Coding sequence length (bp)537
Protein length (aa) 179

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q2U4X9|LCPS_ASPOR Bifunctional lycopene cyclase/phytoene synthase OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=AO090020000159 PE=3 SV=1 34 176 2.0E-33
sp|D4D802|LCPS_TRIVH Bifunctional lycopene cyclase/phytoene synthase OS=Trichophyton verrucosum (strain HKI 0517) GN=TRV_03236 PE=3 SV=1 35 171 2.0E-31
sp|E4UPP6|LCPS_ARTGP Bifunctional lycopene cyclase/phytoene synthase OS=Arthroderma gypseum (strain ATCC MYA-4604 / CBS 118893) GN=MGYG_02096 PE=3 SV=1 35 171 6.0E-31
sp|B2ATB0|LCPS_PODAN Bifunctional lycopene cyclase/phytoene synthase OS=Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) GN=PODANS_1_15240 PE=3 SV=1 34 167 6.0E-29
sp|E4ZUB5|LCPS_LEPMJ Bifunctional lycopene cyclase/phytoene synthase OS=Leptosphaeria maculans (strain JN3 / isolate v23.1.3 / race Av1-4-5-6-7-8) GN=Lema_P114090.1 PE=3 SV=1 34 167 5.0E-28
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q2U4X9|LCPS_ASPOR Bifunctional lycopene cyclase/phytoene synthase OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=AO090020000159 PE=3 SV=1 34 176 2.0E-33
sp|D4D802|LCPS_TRIVH Bifunctional lycopene cyclase/phytoene synthase OS=Trichophyton verrucosum (strain HKI 0517) GN=TRV_03236 PE=3 SV=1 35 171 2.0E-31
sp|E4UPP6|LCPS_ARTGP Bifunctional lycopene cyclase/phytoene synthase OS=Arthroderma gypseum (strain ATCC MYA-4604 / CBS 118893) GN=MGYG_02096 PE=3 SV=1 35 171 6.0E-31
sp|B2ATB0|LCPS_PODAN Bifunctional lycopene cyclase/phytoene synthase OS=Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) GN=PODANS_1_15240 PE=3 SV=1 34 167 6.0E-29
sp|E4ZUB5|LCPS_LEPMJ Bifunctional lycopene cyclase/phytoene synthase OS=Leptosphaeria maculans (strain JN3 / isolate v23.1.3 / race Av1-4-5-6-7-8) GN=Lema_P114090.1 PE=3 SV=1 34 167 5.0E-28
sp|A2QM49|LCPS_ASPNC Bifunctional lycopene cyclase/phytoene synthase OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=An07g00800 PE=3 SV=1 34 177 6.0E-28
sp|E3Q717|LCPS_COLGM Bifunctional lycopene cyclase/phytoene synthase OS=Colletotrichum graminicola (strain M1.001 / M2 / FGSC 10212) GN=GLRG_02475 PE=3 SV=1 34 167 2.0E-27
sp|Q0V6M5|LCPS_PHANO Bifunctional lycopene cyclase/phytoene synthase OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=SNOG_00339 PE=3 SV=1 34 167 1.0E-26
sp|B2WAQ3|LCPS_PYRTR Bifunctional lycopene cyclase/phytoene synthase OS=Pyrenophora tritici-repentis (strain Pt-1C-BFP) GN=PTRG_07366 PE=3 SV=1 37 167 7.0E-26
sp|D1Z4K7|LCPS_SORMK Bifunctional lycopene cyclase/phytoene synthase OS=Sordaria macrospora (strain ATCC MYA-333 / DSM 997 / K(L3346) / K-hell) GN=putative al2 PE=3 SV=1 34 167 1.0E-25
sp|Q8X0Z1|LCPS_GIBFU Bifunctional lycopene cyclase/phytoene synthase OS=Gibberella fujikuroi GN=carRA PE=2 SV=1 34 167 3.0E-25
sp|P37295|LCPS_NEUCR Bifunctional lycopene cyclase/phytoene synthase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=al-2 PE=1 SV=1 34 167 2.0E-23
sp|Q9HNE5|CRTY_HALSA Lycopene beta-cyclase OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=crtY PE=3 SV=2 42 166 5.0E-12
sp|B0R753|CRTY_HALS3 Lycopene beta-cyclase OS=Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1) GN=crtY PE=1 SV=1 42 166 5.0E-12
sp|Q9UUQ6|LCPS_MUCCL Bifunctional lycopene cyclase/phytoene synthase OS=Mucor circinelloides f. lusitanicus GN=CARRP PE=2 SV=1 68 176 6.0E-11
sp|Q9P854|LCPS_PHYB8 Bifunctional lycopene cyclase/phytoene synthase OS=Phycomyces blakesleeanus (strain ATCC 8743b / FGSC 10004 / NBRC 33097 / NRRL 1555) GN=carRA PE=1 SV=1 45 162 3.0E-10
sp|Q67GH9|LCPS_BLATR Bifunctional lycopene cyclase/phytoene synthase OS=Blakeslea trispora GN=carRA PE=1 SV=1 68 162 7.0E-10
sp|Q7Z859|LCPS_PHARH Bifunctional lycopene cyclase/phytoene synthase OS=Phaffia rhodozyma GN=crtYB PE=2 SV=1 45 167 9.0E-10
sp|E6ZZ11|LCPS_SPORE Bifunctional lycopene cyclase/phytoene synthase OS=Sporisorium reilianum (strain SRZ2) GN=sr13176 PE=3 SV=1 64 178 8.0E-09
sp|Q4P0S6|LCPS_USTMA Bifunctional lycopene cyclase/phytoene synthase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=UMAG_06287 PE=3 SV=1 65 167 1.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 26 0.45

Transmembrane Domains

Domain # Start End Length
1 36 55 19
2 70 92 22
3 99 118 19
4 144 166 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|2214
MDYLTGLVDDCRLLAVFLAARDVQDICIGIDRRPDAILGFTLFSIPLEEVFFFVTQTYDTGLLDTHTYMSLILAW
VTPFLTLQWAAGSHFLLALPRARLLLAVALPSVYLCMVDTLALRRGTWVIEDGTKLGYDVLGLIEVEEVVFFFAT
NLMIVVGLVTIDYYIAMEEYQMASSPVP*
Coding >Ophio5|2214
ATGGACTATCTCACCGGCCTTGTTGATGACTGCCGTCTATTGGCCGTTTTTCTCGCGGCTCGAGATGTGCAAGAT
ATCTGCATTGGTATCGATCGCCGTCCGGATGCCATTCTTGGCTTCACCCTATTTTCTATTCCTCTCGAAGAGGTT
TTCTTCTTTGTCACACAGACTTACGACACTGGTCTCTTAGACACGCATACGTACATGAGCCTCATTCTGGCCTGG
GTGACGCCTTTCTTGACACTACAGTGGGCCGCAGGCTCCCACTTCTTGCTGGCGCTGCCTCGTGCAAGATTGCTT
CTCGCAGTTGCGCTGCCTTCGGTCTATCTGTGCATGGTAGACACTTTGGCTTTACGCCGTGGCACATGGGTCATC
GAAGACGGCACAAAGCTCGGGTACGACGTGCTGGGGTTGATCGAGGTAGAGGAGGTCGTCTTTTTCTTTGCTACC
AACCTGATGATTGTCGTCGGCCTCGTTACCATCGACTACTATATCGCCATGGAAGAGTATCAGATGGCCAGCTCG
CCAGTGCCGTGA
Transcript >Ophio5|2214
ATGGACTATCTCACCGGCCTTGTTGATGACTGCCGTCTATTGGCCGTTTTTCTCGCGGCTCGAGATGTGCAAGAT
ATCTGCATTGGTATCGATCGCCGTCCGGATGCCATTCTTGGCTTCACCCTATTTTCTATTCCTCTCGAAGAGGTT
TTCTTCTTTGTCACACAGACTTACGACACTGGTCTCTTAGACACGCATACGTACATGAGCCTCATTCTGGCCTGG
GTGACGCCTTTCTTGACACTACAGTGGGCCGCAGGCTCCCACTTCTTGCTGGCGCTGCCTCGTGCAAGATTGCTT
CTCGCAGTTGCGCTGCCTTCGGTCTATCTGTGCATGGTAGACACTTTGGCTTTACGCCGTGGCACATGGGTCATC
GAAGACGGCACAAAGCTCGGGTACGACGTGCTGGGGTTGATCGAGGTAGAGGAGGTCGTCTTTTTCTTTGCTACC
AACCTGATGATTGTCGTCGGCCTCGTTACCATCGACTACTATATCGCCATGGAAGAGTATCAGATGGCCAGCTCG
CCAGTGCCGTGA
Gene >Ophio5|2214
ATGGACTATCTCACCGGCCTTGTTGATGACTGCCGTCTATTGGCCGTTTTTCTCGCGGCTCGAGATGTGCAAGAT
ATCTGCATTGGTATCGGTATGGACCGCTTCGCCTAATATATATATCTCTGCTTCGGACTCTTTTTAGACTGGAGT
ATCTGACTTGTCGGGATGCTAGATCGCCGTCGTTAGCACACTGCCCTGGGACTCGTTCTTGATCCGCACTCTCCA
GCGGATGCCATTCTTGGCTTCACCCTATTTTCTATTCCTCTCGAAGAGGTTTTCTTCTTTGTCACACAGACTTAC
GACACTGGTCTCTTGTACGTCCTATAAACCAAGCAGCTGGTGTTGCCCGTCTGACTCGGCGAGCAACCGAGTGCG
GTCGGACGGATGGTAGGAGTTGTACTCCTCGGCGGCGTTTTCGTTGTTGCTATTATTGGAATTGTCTGTAGAGAC
ACGCATACGTACATGAGCCTCATTCTGGCCTGGGTGACGCCTTTCTTGACACTACAGTGGTGAGTTGACTCGACA
TAGTCCCCAGGGGCAAGGCTGATAATTTAGCGCAGGGCCGCAGGCTCCCACTTCTTGCTGGCGCTGCCTCGTGCA
AGATTGCTTCTCGCAGTTGCGCTGCCTTCGGTCTATCTGTGCATGGTAGACACTTTGGCTTTACGCCGTGGCACA
TGGGTCATCGAAGACGGCACAAAGCTCGGGTACGACGTGCTGGGGTTGATCGAGGTAGAGTATGTCGACGCTTGT
ACCAGGCGAAGCGGACAGGGGAAAACACGAATAACGAGAGGGGCCATTTCTAGGGAGGTCGTCTTTTTCTTTGCT
ACCAACCTGATGATTGTCGTCGGCCTCGTTACCATCGACTACTATATCGCCATGGAAGAGTATCAGATGGCCAGC
TCGCCAGTGCCGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail