Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|2208
Gene name
Locationscaffold_190:23915..24595
Strand-
Gene length (bp)680
Transcript length (bp)600
Coding sequence length (bp)597
Protein length (aa) 199

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13639 zf-RING_2 Ring finger domain 1.1E-08 123 170
PF12861 zf-ANAPC11 Anaphase-promoting complex subunit 11 RING-H2 finger 5.1E-05 118 172

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P38239|YBR2_YEAST Uncharacterized RING finger protein YBR062C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YBR062C PE=1 SV=2 102 173 1.0E-15
sp|O43164|PJA2_HUMAN E3 ubiquitin-protein ligase Praja-2 OS=Homo sapiens GN=PJA2 PE=1 SV=4 82 189 4.0E-07
sp|A5WWA0|ZNRF3_DANRE E3 ubiquitin-protein ligase ZNRF3 OS=Danio rerio GN=znrf3 PE=1 SV=2 125 181 4.0E-07
sp|Q5R4R1|PJA2_PONAB E3 ubiquitin-protein ligase Praja-2 OS=Pongo abelii GN=PJA2 PE=2 SV=1 82 189 4.0E-07
sp|Q80U04|PJA2_MOUSE E3 ubiquitin-protein ligase Praja-2 OS=Mus musculus GN=Pja2 PE=1 SV=2 82 170 1.0E-06
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P38239|YBR2_YEAST Uncharacterized RING finger protein YBR062C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YBR062C PE=1 SV=2 102 173 1.0E-15
sp|O43164|PJA2_HUMAN E3 ubiquitin-protein ligase Praja-2 OS=Homo sapiens GN=PJA2 PE=1 SV=4 82 189 4.0E-07
sp|A5WWA0|ZNRF3_DANRE E3 ubiquitin-protein ligase ZNRF3 OS=Danio rerio GN=znrf3 PE=1 SV=2 125 181 4.0E-07
sp|Q5R4R1|PJA2_PONAB E3 ubiquitin-protein ligase Praja-2 OS=Pongo abelii GN=PJA2 PE=2 SV=1 82 189 4.0E-07
sp|Q80U04|PJA2_MOUSE E3 ubiquitin-protein ligase Praja-2 OS=Mus musculus GN=Pja2 PE=1 SV=2 82 170 1.0E-06
sp|Q63364|PJA2_RAT E3 ubiquitin-protein ligase Praja-2 OS=Rattus norvegicus GN=Pja2 PE=2 SV=1 82 170 2.0E-06
sp|O55176|PJA1_MOUSE E3 ubiquitin-protein ligase Praja-1 OS=Mus musculus GN=Pja1 PE=1 SV=3 82 170 2.0E-06
sp|Q5SSZ7|ZNRF3_MOUSE E3 ubiquitin-protein ligase ZNRF3 OS=Mus musculus GN=Znrf3 PE=1 SV=1 102 185 3.0E-06
sp|Q84TF5|RHA4A_ARATH RING-H2 zinc finger protein RHA4a OS=Arabidopsis thaliana GN=RHA4A PE=2 SV=1 120 195 3.0E-06
sp|Q8NG27|PJA1_HUMAN E3 ubiquitin-protein ligase Praja-1 OS=Homo sapiens GN=PJA1 PE=1 SV=2 82 170 3.0E-06
sp|Q9CY62|RN181_MOUSE E3 ubiquitin-protein ligase RNF181 OS=Mus musculus GN=Rnf181 PE=1 SV=1 101 173 4.0E-06
sp|Q4KLR8|ZNRF3_XENLA E3 ubiquitin-protein ligase ZNRF3 OS=Xenopus laevis GN=znrf3 PE=2 SV=1 110 177 5.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0031145 anaphase-promoting complex-dependent catabolic process Yes
GO:0005680 anaphase-promoting complex Yes
GO:0008270 zinc ion binding Yes
GO:0061630 ubiquitin protein ligase activity Yes
GO:0097602 cullin family protein binding Yes
GO:0046872 metal ion binding No
GO:0044260 cellular macromolecule metabolic process No
GO:1990234 transferase complex No
GO:0003674 molecular_function No
GO:0044237 cellular metabolic process No
GO:0043169 cation binding No
GO:0043167 ion binding No
GO:0008152 metabolic process No
GO:0019941 modification-dependent protein catabolic process No
GO:1902494 catalytic complex No
GO:0031461 cullin-RING ubiquitin ligase complex No
GO:0030163 protein catabolic process No
GO:0004842 ubiquitin-protein transferase activity No
GO:0044238 primary metabolic process No
GO:0006508 proteolysis No
GO:0005515 protein binding No
GO:0043161 proteasome-mediated ubiquitin-dependent protein catabolic process No
GO:0032991 protein-containing complex No
GO:0000151 ubiquitin ligase complex No
GO:1901564 organonitrogen compound metabolic process No
GO:0008150 biological_process No
GO:0043170 macromolecule metabolic process No
GO:0051603 proteolysis involved in protein catabolic process No
GO:0140513 nuclear protein-containing complex No
GO:0043632 modification-dependent macromolecule catabolic process No
GO:0003824 catalytic activity No
GO:0006807 nitrogen compound metabolic process No
GO:1901575 organic substance catabolic process No
GO:0009057 macromolecule catabolic process No
GO:0000152 nuclear ubiquitin ligase complex No
GO:0044248 cellular catabolic process No
GO:0019787 ubiquitin-like protein transferase activity No
GO:0006511 ubiquitin-dependent protein catabolic process No
GO:0046914 transition metal ion binding No
GO:1901565 organonitrogen compound catabolic process No
GO:0016740 transferase activity No
GO:0005575 cellular_component No
GO:0019538 protein metabolic process No
GO:0009056 catabolic process No
GO:0140535 intracellular protein-containing complex No
GO:0010498 proteasomal protein catabolic process No
GO:0009987 cellular process No
GO:0005488 binding No
GO:0140096 catalytic activity, acting on a protein No
GO:0071704 organic substance metabolic process No
GO:0061659 ubiquitin-like protein ligase activity No
GO:0044265 cellular macromolecule catabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 43 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|2208
MATQYEVEHNVELSAPRRSSRRVDMTSFFSLINSMDSPPGGSRTNPHATPTPFDAAALFRLLRDQLRSLHNTAPT
DGNRNFLEQLMVSLEDDIHDPPAQLPGASQQFVDALDRVARKRLARDDDCAICKVPYLDDEWCLVVELPCAGRHR
FDLECVAPWLRSKGTCPMCRERVGDAKSKQPVVPVTEDDDEDDTDMMYA
Coding >Ophio5|2208
ATGGCCACACAGTACGAAGTCGAGCACAACGTTGAGCTCTCGGCGCCTCGGCGATCATCGCGCCGTGTCGATATG
ACTTCCTTCTTCTCGCTCATCAACTCGATGGACTCGCCTCCAGGCGGCTCCCGTACGAACCCGCACGCCACGCCC
ACTCCATTCGACGCCGCCGCCCTCTTCCGCCTGCTGCGCGACCAGCTGCGCTCTCTGCATAACACGGCGCCCACA
GACGGCAACCGTAATTTTCTCGAGCAGCTCATGGTCTCGCTCGAAGACGACATTCACGATCCGCCCGCTCAGCTG
CCCGGTGCTTCCCAGCAGTTTGTCGATGCTCTCGACCGCGTGGCTCGCAAGCGTCTGGCTCGCGACGACGATTGC
GCCATATGCAAGGTCCCGTATCTTGATGACGAATGGTGTCTTGTCGTTGAGCTGCCGTGCGCTGGCCGTCATCGC
TTCGACCTTGAGTGCGTCGCCCCTTGGCTGCGCAGCAAGGGCACTTGTCCCATGTGTCGTGAGCGCGTGGGCGAC
GCCAAGAGCAAGCAGCCGGTTGTACCTGTCACCGAAGACGACGATGAAGATGATACGGATATGATGTACGCC
Transcript >Ophio5|2208
ATGGCCACACAGTACGAAGTCGAGCACAACGTTGAGCTCTCGGCGCCTCGGCGATCATCGCGCCGTGTCGATATG
ACTTCCTTCTTCTCGCTCATCAACTCGATGGACTCGCCTCCAGGCGGCTCCCGTACGAACCCGCACGCCACGCCC
ACTCCATTCGACGCCGCCGCCCTCTTCCGCCTGCTGCGCGACCAGCTGCGCTCTCTGCATAACACGGCGCCCACA
GACGGCAACCGTAATTTTCTCGAGCAGCTCATGGTCTCGCTCGAAGACGACATTCACGATCCGCCCGCTCAGCTG
CCCGGTGCTTCCCAGCAGTTTGTCGATGCTCTCGACCGCGTGGCTCGCAAGCGTCTGGCTCGCGACGACGATTGC
GCCATATGCAAGGTCCCGTATCTTGATGACGAATGGTGTCTTGTCGTTGAGCTGCCGTGCGCTGGCCGTCATCGC
TTCGACCTTGAGTGCGTCGCCCCTTGGCTGCGCAGCAAGGGCACTTGTCCCATGTGTCGTGAGCGCGTGGGCGAC
GCCAAGAGCAAGCAGCCGGTTGTACCTGTCACCGAAGACGACGATGAAGATGATACGGATATGATGTACGCCTGA
Gene >Ophio5|2208
ATGGCCACACAGTACGAAGGTAGCCTACCTACTCACCTAACTACCAAACCAACCTAAACCGATTCCCTCCATCCA
TGGCGACGCTGACAAGACGCAAAGTCGAGCACAACGTTGAGCTCTCGGCGCCTCGGCGATCATCGCGCCGTGTCG
ATATGACTTCCTTCTTCTCGCTCATCAACTCGATGGACTCGCCTCCAGGCGGCTCCCGTACGAACCCGCACGCCA
CGCCCACTCCATTCGACGCCGCCGCCCTCTTCCGCCTGCTGCGCGACCAGCTGCGCTCTCTGCATAACACGGCGC
CCACAGACGGCAACCGTAATTTTCTCGAGCAGCTCATGGTCTCGCTCGAAGACGACATTCACGATCCGCCCGCTC
AGCTGCCCGGTGCTTCCCAGCAGTTTGTCGATGCTCTCGACCGCGTGGCTCGCAAGCGTCTGGCTCGCGACGACG
ATTGCGCCATATGCAAGGTCCCGTATCTTGATGACGAATGGTGTCTTGTCGTTGAGCTGCCGTGCGCTGGCCGTC
ATCGCTTCGACCTTGAGTGCGTCGCCCCTTGGCTGCGCAGCAAGGGCACTTGTCCCATGTGTCGTGAGCGCGTGG
GCGACGCCAAGAGCAAGCAGCCGGTTGTACCTGTCACCGAAGACGACGATGAAGATGATACGGATATGATGTACG
CCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail