Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|2207
Gene name
Locationscaffold_190:22628..23552
Strand+
Gene length (bp)924
Transcript length (bp)858
Coding sequence length (bp)855
Protein length (aa) 285

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12311 DUF3632 Protein of unknown function (DUF3632) 2.3E-35 75 255

Swissprot hits

(None)

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Nucleus Nuclear export signal 0.6747 0.7004 0.0975 0.0269 0.0823 0.0213 0.0678 0.2056 0.2012 0.0697

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup618
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|731
Ophiocordyceps australis 1348a (Ghana) OphauG2|732
Ophiocordyceps australis map64 (Brazil) OphauB2|450
Ophiocordyceps australis map64 (Brazil) OphauB2|451
Ophiocordyceps camponoti-floridani Ophcf2|01245
Ophiocordyceps camponoti-rufipedis Ophun1|3246
Ophiocordyceps kimflemingae Ophio5|2206
Ophiocordyceps kimflemingae Ophio5|2207 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|2207
MAAPPHVDLSGLTSSASPSSSSSALSSHEAGILRVLSATINDGEPKASSAAETLDELYPAGDDVGAIEDYLWSLW
SLLVGAVKKIPAQDKRQQLIVDVIARLRDSRDQEVELWGQKTKVWSELPMLGPCMRDAWNLRPKLDGSDKDNAAI
CEWTSLNSFAARMFGADLQPWINLAIWELRAALEEPPPSTTTARDAGIATVCEWITHARDQLHRQGRQPRSLDPM
EERALKPGKLFQGGDSGLSDARWHFWRQRLAELGGDAGSAELRERAKTAVAQMEELESSA
Coding >Ophio5|2207
ATGGCCGCCCCTCCTCACGTCGACCTCTCCGGCCTCACGTCGTCAGCCTCGCCTTCCTCGTCGTCCTCGGCGCTC
TCGTCGCACGAAGCCGGTATCCTCCGCGTCCTGTCGGCTACAATCAACGACGGCGAGCCCAAGGCCAGTAGCGCC
GCCGAGACGCTCGATGAGCTGTACCCCGCGGGTGACGACGTCGGTGCCATCGAGGACTATCTGTGGTCGCTGTGG
TCGCTGCTCGTCGGAGCTGTCAAGAAGATTCCGGCCCAAGATAAGCGGCAGCAGCTCATCGTCGACGTCATCGCC
CGTCTTCGCGACAGCCGCGATCAAGAGGTCGAGCTCTGGGGCCAGAAGACCAAGGTGTGGTCCGAGCTGCCCATG
TTGGGACCCTGCATGAGGGACGCGTGGAACCTACGTCCAAAGCTCGATGGCTCCGACAAGGACAACGCCGCCATC
TGCGAATGGACCTCGCTCAACTCCTTCGCCGCCCGCATGTTCGGCGCCGACCTCCAGCCGTGGATCAACCTGGCC
ATCTGGGAGCTCCGCGCCGCGCTCGAAGAGCCACCTCCGTCAACGACGACGGCCCGCGATGCCGGCATAGCCACC
GTATGCGAATGGATCACTCACGCCCGCGACCAGCTGCACCGCCAGGGCCGCCAGCCGCGTTCCCTCGACCCCATG
GAGGAGAGGGCCCTCAAACCCGGCAAGCTGTTCCAGGGCGGCGACTCGGGTCTCAGCGATGCCAGGTGGCACTTC
TGGCGCCAGAGGTTGGCCGAGCTGGGGGGCGACGCGGGCAGCGCCGAGCTGAGGGAGCGGGCTAAGACGGCCGTG
GCGCAGATGGAGGAGCTCGAGTCTTCGGCG
Transcript >Ophio5|2207
ATGGCCGCCCCTCCTCACGTCGACCTCTCCGGCCTCACGTCGTCAGCCTCGCCTTCCTCGTCGTCCTCGGCGCTC
TCGTCGCACGAAGCCGGTATCCTCCGCGTCCTGTCGGCTACAATCAACGACGGCGAGCCCAAGGCCAGTAGCGCC
GCCGAGACGCTCGATGAGCTGTACCCCGCGGGTGACGACGTCGGTGCCATCGAGGACTATCTGTGGTCGCTGTGG
TCGCTGCTCGTCGGAGCTGTCAAGAAGATTCCGGCCCAAGATAAGCGGCAGCAGCTCATCGTCGACGTCATCGCC
CGTCTTCGCGACAGCCGCGATCAAGAGGTCGAGCTCTGGGGCCAGAAGACCAAGGTGTGGTCCGAGCTGCCCATG
TTGGGACCCTGCATGAGGGACGCGTGGAACCTACGTCCAAAGCTCGATGGCTCCGACAAGGACAACGCCGCCATC
TGCGAATGGACCTCGCTCAACTCCTTCGCCGCCCGCATGTTCGGCGCCGACCTCCAGCCGTGGATCAACCTGGCC
ATCTGGGAGCTCCGCGCCGCGCTCGAAGAGCCACCTCCGTCAACGACGACGGCCCGCGATGCCGGCATAGCCACC
GTATGCGAATGGATCACTCACGCCCGCGACCAGCTGCACCGCCAGGGCCGCCAGCCGCGTTCCCTCGACCCCATG
GAGGAGAGGGCCCTCAAACCCGGCAAGCTGTTCCAGGGCGGCGACTCGGGTCTCAGCGATGCCAGGTGGCACTTC
TGGCGCCAGAGGTTGGCCGAGCTGGGGGGCGACGCGGGCAGCGCCGAGCTGAGGGAGCGGGCTAAGACGGCCGTG
GCGCAGATGGAGGAGCTCGAGTCTTCGGCGTGA
Gene >Ophio5|2207
ATGGCCGCCCCTCCTCACGTCGACCTCTCCGGCCTCACGTCGTCAGCCTCGCCTTCCTCGTCGTCCTCGGCGCTC
TCGTCGCACGAAGCCGGTATCCTCCGCGTCCTGTCGGCTACAATCAACGACGGCGAGCCCAAGGCCAGTAGCGCC
GCCGAGACGCTCGATGAGCTGTACCCCGCGGGTGACGACGTCGGTGCCATCGAGGACTATCTGTGGTCGCTGTGG
TCGCTGCTCGTCGGAGCTGTCAAGAAGATTCCGGCCCAAGATAAGCGGCAGCAGCTCATCGTCGACGTCATCGCC
CGTCTTCGCGACAGCCGCGATCAAGAGGTCGAGCTCTGGGGCCAGAAGACCAAGGTGTGGTCCGAGCTGCCCATG
TTGGGACCCTGCATGAGGGACGCGTGGAACCGTACGTTCTGTCCACTGTAGTCCAATCCTTCACCTCTTCCGCCC
TTCTAAAACAGCACGACAAAAGTACGTCCAAAGCTCGATGGCTCCGACAAGGACAACGCCGCCATCTGCGAATGG
ACCTCGCTCAACTCCTTCGCCGCCCGCATGTTCGGCGCCGACCTCCAGCCGTGGATCAACCTGGCCATCTGGGAG
CTCCGCGCCGCGCTCGAAGAGCCACCTCCGTCAACGACGACGGCCCGCGATGCCGGCATAGCCACCGTATGCGAA
TGGATCACTCACGCCCGCGACCAGCTGCACCGCCAGGGCCGCCAGCCGCGTTCCCTCGACCCCATGGAGGAGAGG
GCCCTCAAACCCGGCAAGCTGTTCCAGGGCGGCGACTCGGGTCTCAGCGATGCCAGGTGGCACTTCTGGCGCCAG
AGGTTGGCCGAGCTGGGGGGCGACGCGGGCAGCGCCGAGCTGAGGGAGCGGGCTAAGACGGCCGTGGCGCAGATG
GAGGAGCTCGAGTCTTCGGCGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail