Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|2204
Gene name
Locationscaffold_190:14188..16002
Strand+
Gene length (bp)1814
Transcript length (bp)1668
Coding sequence length (bp)1665
Protein length (aa) 555

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08601 PAP1 Transcription factor PAP1 1.0E-08 274 368
PF08601 PAP1 Transcription factor PAP1 1.2E-58 381 524
PF00170 bZIP_1 bZIP transcription factor 9.4E-08 163 210

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P56095|AP1_KLULA AP-1-like transcription factor OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=YAP1 PE=3 SV=1 119 260 4.0E-20
sp|Q5AJU7|YAP1_CANAL AP-1-like transcription factor CAP1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CAP1 PE=1 SV=1 133 221 1.0E-15
sp|Q01663|AP1_SCHPO AP-1-like transcription factor OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pap1 PE=1 SV=2 148 222 1.0E-13
sp|P19880|YAP1_YEAST AP-1-like transcription factor YAP1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YAP1 PE=1 SV=2 159 222 5.0E-10
sp|P19880|YAP1_YEAST AP-1-like transcription factor YAP1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YAP1 PE=1 SV=2 471 527 6.0E-09
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P56095|AP1_KLULA AP-1-like transcription factor OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=YAP1 PE=3 SV=1 119 260 4.0E-20
sp|Q5AJU7|YAP1_CANAL AP-1-like transcription factor CAP1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CAP1 PE=1 SV=1 133 221 1.0E-15
sp|Q01663|AP1_SCHPO AP-1-like transcription factor OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pap1 PE=1 SV=2 148 222 1.0E-13
sp|P19880|YAP1_YEAST AP-1-like transcription factor YAP1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YAP1 PE=1 SV=2 159 222 5.0E-10
sp|P19880|YAP1_YEAST AP-1-like transcription factor YAP1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YAP1 PE=1 SV=2 471 527 6.0E-09
sp|Q5AJU7|YAP1_CANAL AP-1-like transcription factor CAP1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CAP1 PE=1 SV=1 469 526 2.0E-08
sp|P24813|YAP2_YEAST AP-1-like transcription activator YAP2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CAD1 PE=1 SV=2 150 195 7.0E-08
sp|Q01663|AP1_SCHPO AP-1-like transcription factor OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pap1 PE=1 SV=2 428 525 6.0E-07
sp|Q8X229|FCR3_CANAX Fluconazole resistance protein 3 OS=Candida albicans GN=FCR3 PE=3 SV=1 159 261 7.0E-07
sp|P56095|AP1_KLULA AP-1-like transcription factor OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=YAP1 PE=3 SV=1 441 526 9.0E-07
sp|P40574|YAP5_YEAST AP-1-like transcription factor YAP5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YAP5 PE=1 SV=1 159 255 8.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0006355 regulation of transcription, DNA-templated Yes
GO:0003700 DNA-binding transcription factor activity Yes
GO:0051171 regulation of nitrogen compound metabolic process No
GO:0008150 biological_process No
GO:0060255 regulation of macromolecule metabolic process No
GO:0019222 regulation of metabolic process No
GO:0050794 regulation of cellular process No
GO:0140110 transcription regulator activity No
GO:0031323 regulation of cellular metabolic process No
GO:0065007 biological regulation No
GO:0010468 regulation of gene expression No
GO:0003674 molecular_function No
GO:0019219 regulation of nucleobase-containing compound metabolic process No
GO:0051252 regulation of RNA metabolic process No
GO:0080090 regulation of primary metabolic process No
GO:0009889 regulation of biosynthetic process No
GO:0050789 regulation of biological process No
GO:1903506 regulation of nucleic acid-templated transcription No
GO:2001141 regulation of RNA biosynthetic process No
GO:0010556 regulation of macromolecule biosynthetic process No
GO:0031326 regulation of cellular biosynthetic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 40 0.45

Transmembrane Domains

(None)

Transcription Factor Class

Transcription Factor Class
(based on PFAM domains)
bZIP

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|2204
MPPAEADDGAGSVPPNFFLTPHQQNLLFAALNTNRQTSAATGAFPAPGAVSLSPTSFQSSPLPSLDGGARYQESP
YLDKYDYDFGDSSFDFSLATVDQSQTANDGPATVKSDSTEADSNEKRHHPDDEEPGDSPGNDSKRHEASEKAPKK
PGRKPLTSEPTSKRKAQNRAAQRAFRERKEKHLKDLETKVHELEKASEAANHENSKLRTQLNGITTELNHYKQRL
AVLTNTTKAVPRDGMPLSNPLLGNLADLNFPFEFPKFGSPLVADKSATQNGQAAQRQSFGDKTSPTSVRPSAHDE
YGRLSSMTSSRASVDGFGGATSSPSASSNSNAGGPVSSCGTSPEPPNHSPMGSKPLETLTTIGEEQPGAVGTLAG
HFPPADNHAASFDWLASQNGGQFDPQLFGDYREPQDNILSGTNIDDFFNDALDADFLTPYNVPPLAAPPGPKRNL
IDEIDAEQNALDEDLPKEQNVRCTKIWDRLQGCPKAQSGEFDLDGLCSELTQKAKCSGHGPVVAERDFDSILRKY
MGKDVSPHCVASSLGFEVHPDEKPNGVVMP
Coding >Ophio5|2204
ATGCCTCCCGCCGAGGCCGACGACGGAGCTGGCTCCGTGCCGCCCAACTTCTTCTTGACGCCGCACCAGCAGAAT
CTTCTCTTTGCCGCCCTGAATACCAATAGGCAAACGTCCGCTGCAACTGGCGCCTTTCCTGCTCCGGGAGCCGTC
TCTCTGTCGCCTACGTCGTTTCAGAGCTCGCCTCTGCCGTCCCTTGACGGCGGTGCCCGCTATCAGGAGAGCCCT
TACCTCGACAAGTACGACTATGATTTCGGCGACTCTAGTTTCGATTTTTCCTTGGCCACCGTCGATCAGTCCCAA
ACGGCAAACGATGGCCCAGCCACCGTCAAGTCCGATTCGACCGAGGCCGACTCCAACGAGAAGCGGCACCACCCG
GACGACGAGGAGCCCGGCGACAGCCCTGGCAACGACTCCAAGCGCCATGAGGCCTCCGAAAAAGCCCCTAAAAAG
CCTGGCCGGAAGCCCCTGACTTCCGAGCCCACTTCGAAGCGCAAGGCCCAGAACCGTGCTGCACAGCGTGCGTTT
AGGGAGCGCAAGGAAAAGCATCTCAAGGACCTCGAGACTAAGGTTCACGAGTTGGAGAAGGCCTCCGAGGCGGCC
AATCACGAGAATAGCAAGCTGCGGACGCAGCTCAACGGCATCACCACCGAGCTCAACCACTATAAGCAGAGGCTG
GCCGTTCTGACCAACACCACCAAGGCCGTCCCTCGCGATGGCATGCCCCTGAGCAACCCCCTCCTCGGCAACCTG
GCCGACCTGAACTTCCCCTTCGAGTTTCCCAAGTTCGGCTCCCCCCTCGTGGCCGACAAGTCCGCTACACAAAAT
GGTCAAGCCGCCCAGCGCCAGAGCTTTGGCGACAAGACGTCGCCCACGTCTGTTCGGCCCTCAGCCCACGACGAA
TATGGCAGGCTGTCTTCCATGACAAGCTCGCGAGCCAGCGTCGATGGCTTCGGGGGAGCGACGAGCTCGCCGTCG
GCGTCGTCCAACTCCAACGCGGGAGGGCCCGTCTCGTCGTGCGGCACCTCGCCGGAGCCGCCCAATCACTCCCCC
ATGGGCTCTAAGCCGCTCGAGACGCTGACCACCATCGGCGAGGAGCAACCGGGCGCCGTTGGCACCCTGGCCGGC
CATTTCCCCCCTGCCGACAACCATGCCGCCAGCTTCGACTGGCTGGCCAGCCAGAACGGTGGCCAGTTCGATCCG
CAGCTGTTCGGCGACTACCGCGAGCCCCAGGACAATATCCTGTCCGGCACCAACATCGACGACTTCTTCAACGAC
GCCCTCGACGCAGACTTCCTTACGCCCTACAACGTCCCCCCCCTGGCCGCGCCGCCGGGACCCAAGCGGAATCTC
ATCGACGAGATTGACGCCGAGCAGAACGCGCTGGACGAGGATCTGCCCAAGGAGCAAAACGTCCGGTGCACAAAG
ATTTGGGACAGGCTGCAGGGCTGCCCCAAGGCCCAGAGCGGCGAGTTTGACCTCGACGGCCTCTGCTCGGAGCTC
ACGCAAAAGGCAAAGTGCTCAGGCCACGGTCCCGTCGTCGCCGAGCGCGACTTCGACTCCATCCTGAGAAAGTAC
ATGGGCAAGGACGTGTCGCCCCATTGCGTCGCCTCCTCCCTCGGCTTCGAAGTCCATCCGGACGAGAAGCCCAAC
GGCGTGGTTATGCCT
Transcript >Ophio5|2204
ATGCCTCCCGCCGAGGCCGACGACGGAGCTGGCTCCGTGCCGCCCAACTTCTTCTTGACGCCGCACCAGCAGAAT
CTTCTCTTTGCCGCCCTGAATACCAATAGGCAAACGTCCGCTGCAACTGGCGCCTTTCCTGCTCCGGGAGCCGTC
TCTCTGTCGCCTACGTCGTTTCAGAGCTCGCCTCTGCCGTCCCTTGACGGCGGTGCCCGCTATCAGGAGAGCCCT
TACCTCGACAAGTACGACTATGATTTCGGCGACTCTAGTTTCGATTTTTCCTTGGCCACCGTCGATCAGTCCCAA
ACGGCAAACGATGGCCCAGCCACCGTCAAGTCCGATTCGACCGAGGCCGACTCCAACGAGAAGCGGCACCACCCG
GACGACGAGGAGCCCGGCGACAGCCCTGGCAACGACTCCAAGCGCCATGAGGCCTCCGAAAAAGCCCCTAAAAAG
CCTGGCCGGAAGCCCCTGACTTCCGAGCCCACTTCGAAGCGCAAGGCCCAGAACCGTGCTGCACAGCGTGCGTTT
AGGGAGCGCAAGGAAAAGCATCTCAAGGACCTCGAGACTAAGGTTCACGAGTTGGAGAAGGCCTCCGAGGCGGCC
AATCACGAGAATAGCAAGCTGCGGACGCAGCTCAACGGCATCACCACCGAGCTCAACCACTATAAGCAGAGGCTG
GCCGTTCTGACCAACACCACCAAGGCCGTCCCTCGCGATGGCATGCCCCTGAGCAACCCCCTCCTCGGCAACCTG
GCCGACCTGAACTTCCCCTTCGAGTTTCCCAAGTTCGGCTCCCCCCTCGTGGCCGACAAGTCCGCTACACAAAAT
GGTCAAGCCGCCCAGCGCCAGAGCTTTGGCGACAAGACGTCGCCCACGTCTGTTCGGCCCTCAGCCCACGACGAA
TATGGCAGGCTGTCTTCCATGACAAGCTCGCGAGCCAGCGTCGATGGCTTCGGGGGAGCGACGAGCTCGCCGTCG
GCGTCGTCCAACTCCAACGCGGGAGGGCCCGTCTCGTCGTGCGGCACCTCGCCGGAGCCGCCCAATCACTCCCCC
ATGGGCTCTAAGCCGCTCGAGACGCTGACCACCATCGGCGAGGAGCAACCGGGCGCCGTTGGCACCCTGGCCGGC
CATTTCCCCCCTGCCGACAACCATGCCGCCAGCTTCGACTGGCTGGCCAGCCAGAACGGTGGCCAGTTCGATCCG
CAGCTGTTCGGCGACTACCGCGAGCCCCAGGACAATATCCTGTCCGGCACCAACATCGACGACTTCTTCAACGAC
GCCCTCGACGCAGACTTCCTTACGCCCTACAACGTCCCCCCCCTGGCCGCGCCGCCGGGACCCAAGCGGAATCTC
ATCGACGAGATTGACGCCGAGCAGAACGCGCTGGACGAGGATCTGCCCAAGGAGCAAAACGTCCGGTGCACAAAG
ATTTGGGACAGGCTGCAGGGCTGCCCCAAGGCCCAGAGCGGCGAGTTTGACCTCGACGGCCTCTGCTCGGAGCTC
ACGCAAAAGGCAAAGTGCTCAGGCCACGGTCCCGTCGTCGCCGAGCGCGACTTCGACTCCATCCTGAGAAAGTAC
ATGGGCAAGGACGTGTCGCCCCATTGCGTCGCCTCCTCCCTCGGCTTCGAAGTCCATCCGGACGAGAAGCCCAAC
GGCGTGGTTATGCCTTAG
Gene >Ophio5|2204
ATGCCTCCCGCCGAGGCCGACGACGGAGCTGGCTCCGTGCCGCCCAACTTCTTCTTGACGCCGCACCAGCAGAAT
CTTCTCTTTGCCGCCCTGAATACCAATAGGCAAACGTCCGCTGCAACTGGCGCCTTTCCTGCTCCGGGAGCCGTC
TCTCTGTCGCCTACGTCGTTTCAGAGCTCGCCTCTGCCGTCCCTTGACGGCGGTGCCCGCTATCAGGAGAGCCCT
TACCTCGACAAGTACGACTATGATTTCGGCGACTCTAGTTTCGATTTTTCCTTGGCCACCGTCGATCAGTCCCAA
ACGGCAAACGATGGCCCAGCCACCGTCAAGTCCGATTCGACCGAGGCCGACTCCAACGAGAAGCGGCACCACCCG
GACGACGAGGAGCCCGGCGACAGCCCTGGCAACGACTCCAAGCGCCATGAGGCCTCCGAAAAAGCCCCTAAAAAG
CCTGGCCGGAAGCCCCTGACTTCCGAGCCCACTTCGGTAAGCGTTCCATGCCGACTCTCCGTCCGGCCCACCGAC
CCGCTGAATAGCCACCGCAGAAGCGCAAGGCCCAGAACCGTGCTGCACAGCGTGCGTTTAGGGAGCGCAAGGAAA
AGCATCTCAAGGACCTCGAGACTAAGGTTCACGAGTTGGAGAAGGCCTCCGAGGCGGCCAATCACGAGAATAGCA
AGCTGCGGACGCAGCTCAACGGCATCACCACCGAGCTCAACCACTATAAGCAGAGGCTGGCCGTTCTGACCAACA
CCACCAAGGCCGTCCCTCGCGATGGCATGCCCCTGAGCAACCCCCTCCTCGGCAACCTGGCCGACCTGAACTTCC
CCTTCGAGTTTCCCAAGTTCGGCTCCCCCCTCGTGGCCGACAAGTCCGCTACACAAAATGGTCAAGCCGCCCAGC
GCCAGAGCTTTGGCGACAAGACGTCGCCCACGTCTGTTCGGCCCTCAGCCCACGACGAATATGGCAGGCTGTCTT
CCATGACAAGCTCGCGAGCCAGCGTCGATGGCTTCGGGGGAGCGACGAGCTCGCCGTCGGCGTCGTCCAACTCCA
ACGCGGGAGGGCCCGTCTCGTCGTGCGGCACCTCGCCGGAGCCGCCCAATCACTCCCCCATGGGCTCTAAGCCGC
TCGAGACGCTGACCACCATCGGCGAGGAGCAACCGGGCGCCGTTGGCACCCTGGCCGGCCATTTCCCCCCTGCCG
ACAACCATGCCGCCAGCTTCGACTGGCTGGCCAGCCAGAACGGTGGCCAGTTCGATCCGCAGCTGTTCGGCGACT
ACCGCGAGCCCCAGGACAATATCCTGTCCGGCACCAACATCGACGACTTCTTCAACGACGCCCTCGACGCAGACT
TCCTTACGCCCTACAACGTCCCCCCCCTGGCCGCGCCGCCGGGACCCAAGCGGAATCTCATCGACGAGATTGACG
CCGAGCAGAACGCGCTGGACGAGGATCTGCCCAAGGAGCAAAACGTCCGGTGCACAAAGATTTGGTATCTACAGC
TCAAGCTTCCGCCCCTCATCTCCCTGACTGTCCGTCCGTCGCTGACCCATTGTTCTCCTTCTTTTCCACCTTACA
GGGACAGGCTGCAGGGCTGCCCCAAGGCCCAGAGCGGCGAGTTTGACCTCGACGGCCTCTGCTCGGAGCTCACGC
AAAAGGCAAAGTGCTCAGGCCACGGTCCCGTCGTCGCCGAGCGCGACTTCGACTCCATCCTGAGAAAGTACATGG
GCAAGGACGTGTCGCCCCATTGCGTCGCCTCCTCCCTCGGCTTCGAAGTCCATCCGGACGAGAAGCCCAACGGCG
TGGTTATGCCTTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail