Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|22
Gene name
Locationscaffold_1:47141..48174
Strand-
Gene length (bp)1033
Transcript length (bp)927
Coding sequence length (bp)924
Protein length (aa) 308

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF06766 Hydrophobin_2 Fungal hydrophobin 5.3E-16 248 305

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q06153|CEUL_OPHUL Cerato-ulmin OS=Ophiostoma ulmi GN=CU PE=1 SV=1 243 307 1.0E-07
sp|Q9UVI4|THYD_CLAFS Trihydrophobin OS=Claviceps fusiformis GN=TH1 PE=1 SV=1 250 302 9.0E-06

GO

GO Term Description Terminal node
GO:0005576 extracellular region Yes
GO:0110165 cellular anatomical entity No
GO:0005575 cellular_component No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 17 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|22
MKFFAPAYLLLATALAAPHNGGYSTPSENTPASQEDSHHHNGDFSSHSGDYGMPKGGNGGMHGGNSGSGGYNIKN
DNGKGHHGGNGNGDYDIGGHGNNGDNDSGSGGYGNDDMSSHGNGHHGGNGDGGYGDGGFDNDAYDNDDNKKNNGN
KGWDNSNGGYGNGGYGKFGNGKFGNGKHGNSGNGNGNNGNGNGDNGNNGGNGNNGNGNGNGNSGNGNGNNGNGNG
GAAMPLCGGPSTGGLLGGLLESHEPRCCSIDVLGLADVSCEKPSGSPSSPSELKETCSKVGKEARCCALGLGNLA
DLICKPVA
Coding >Ophio5|22
ATGAAGTTCTTCGCCCCCGCCTACCTTCTCCTGGCTACTGCCCTGGCCGCTCCTCACAACGGAGGCTACAGCACG
CCTTCTGAGAACACGCCCGCAAGCCAAGAAGACAGCCACCACCACAATGGAGACTTCTCATCTCACAGCGGCGAC
TATGGGATGCCCAAAGGCGGAAACGGTGGCATGCACGGCGGAAACAGTGGCAGTGGTGGATACAACATCAAGAAC
GACAATGGAAAGGGTCATCACGGCGGCAATGGGAACGGTGACTATGACATTGGCGGCCATGGAAACAACGGCGAC
AACGACAGCGGCAGCGGCGGATATGGCAACGATGACATGAGCAGCCACGGAAACGGCCACCATGGCGGCAATGGA
GATGGCGGTTACGGCGATGGCGGCTTTGACAACGACGCATATGACAACGACGACAACAAGAAGAATAATGGAAAC
AAGGGCTGGGACAACAGCAATGGCGGCTACGGCAATGGCGGCTACGGCAAGTTTGGCAACGGCAAGTTTGGCAAC
GGCAAGCACGGAAATAGCGGGAACGGCAACGGTAACAACGGGAACGGCAACGGCGACAATGGCAATAATGGTGGC
AACGGCAACAATGGAAACGGCAACGGAAACGGCAATAGTGGAAACGGCAACGGCAACAATGGAAACGGCAACGGC
GGAGCTGCCATGCCCCTGTGCGGCGGTCCCTCCACCGGTGGACTTCTCGGAGGACTTCTCGAAAGCCACGAGCCT
CGCTGCTGCAGCATCGACGTGCTCGGCTTGGCGGACGTCAGCTGCGAGAAGCCATCTGGTTCGCCCTCGAGCCCT
TCGGAGCTCAAGGAGACGTGCTCAAAGGTCGGCAAGGAGGCTCGATGCTGCGCCCTGGGTCTGGGTAACCTTGCC
GACCTAATCTGCAAGCCCGTCGCC
Transcript >Ophio5|22
ATGAAGTTCTTCGCCCCCGCCTACCTTCTCCTGGCTACTGCCCTGGCCGCTCCTCACAACGGAGGCTACAGCACG
CCTTCTGAGAACACGCCCGCAAGCCAAGAAGACAGCCACCACCACAATGGAGACTTCTCATCTCACAGCGGCGAC
TATGGGATGCCCAAAGGCGGAAACGGTGGCATGCACGGCGGAAACAGTGGCAGTGGTGGATACAACATCAAGAAC
GACAATGGAAAGGGTCATCACGGCGGCAATGGGAACGGTGACTATGACATTGGCGGCCATGGAAACAACGGCGAC
AACGACAGCGGCAGCGGCGGATATGGCAACGATGACATGAGCAGCCACGGAAACGGCCACCATGGCGGCAATGGA
GATGGCGGTTACGGCGATGGCGGCTTTGACAACGACGCATATGACAACGACGACAACAAGAAGAATAATGGAAAC
AAGGGCTGGGACAACAGCAATGGCGGCTACGGCAATGGCGGCTACGGCAAGTTTGGCAACGGCAAGTTTGGCAAC
GGCAAGCACGGAAATAGCGGGAACGGCAACGGTAACAACGGGAACGGCAACGGCGACAATGGCAATAATGGTGGC
AACGGCAACAATGGAAACGGCAACGGAAACGGCAATAGTGGAAACGGCAACGGCAACAATGGAAACGGCAACGGC
GGAGCTGCCATGCCCCTGTGCGGCGGTCCCTCCACCGGTGGACTTCTCGGAGGACTTCTCGAAAGCCACGAGCCT
CGCTGCTGCAGCATCGACGTGCTCGGCTTGGCGGACGTCAGCTGCGAGAAGCCATCTGGTTCGCCCTCGAGCCCT
TCGGAGCTCAAGGAGACGTGCTCAAAGGTCGGCAAGGAGGCTCGATGCTGCGCCCTGGGTCTGGGTAACCTTGCC
GACCTAATCTGCAAGCCCGTCGCCTAA
Gene >Ophio5|22
ATGAAGTTCTTCGCCCCCGCCTACCTTCTCCTGGCTACTGCCCTGGCCGCTCCTCACAACGGAGGCTACAGCACG
CCTTCTGAGAACACGCCCGCAAGCCAAGAAGACAGCCACCACCACAATGGAGACTTCTCATCTCACAGCGGCGAC
TATGGGATGCCCAAAGGCGGAAACGGTGGCATGCACGGCGGAAACAGTGGCAGTGGTGGATACAACATCAAGAAC
GACAATGGAAAGGGTCATCACGGCGGCAATGGGAACGGTGACTATGACATTGGCGGCCATGGAAACAACGGCGAC
AACGACAGCGGCAGCGGCGGATATGGCAACGATGACATGAGCAGCCACGGAAACGGCCACCATGGCGGCAATGGA
GATGGCGGTTACGGCGATGGCGGCTTTGACAACGACGCATATGACAACGACGACAACAAGAAGAATAATGGAAAC
AAGGGCTGGGACAACAGCAATGGCGGCTACGGCAATGGCGGCTACGGCAAGTTTGGCAACGGCAAGTTTGGCAAC
GGCAAGCACGGAAATAGCGGGAACGGCAACGGTAACAACGGGAACGGCAACGGCGACAATGGCAATAATGGTGGC
AACGGCAACAATGGAAACGGCAACGGAAACGGCAATAGTGGAAACGGCAACGGCAACAATGGAAACGGCAACGGC
GGAGCTGCCATGCCCCTGTGCGGCGGTCCCTCCACCGGTGGACTTCTCGGAGGACTTCTCGAAAGCCACGAGCCT
CGCTGCTGCAGCATCGACGTGCTCGGCTTGGCGGACGTCAGCTGCGAGAAGCGTATGTGACCCATGCCTCATTAT
GATCTAGTCTGCTAACATGGACATAGCATCTGGTTCGCCCTCGAGCCCTTCGGAGCTCAAGGAGACGTGCTCAAA
GGTCGGCAAGGAGGCTCGATGCTGCGCCCTGGGTCTGGTAAGTCTCCCACCAACTGCTCAGTGACAGTGATAGCA
GAAGTTAATCAGACGACAGGGTAACCTTGCCGACCTAATCTGCAAGCCCGTCGCCTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail