Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|22
Gene name
Locationscaffold_1:47141..48174
Strand-
Gene length (bp)1033
Transcript length (bp)927
Coding sequence length (bp)924
Protein length (aa) 308

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF06766 Hydrophobin_2 Fungal hydrophobin 5.3E-16 248 305

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q06153|CEUL_OPHUL Cerato-ulmin OS=Ophiostoma ulmi GN=CU PE=1 SV=1 243 307 1.0E-07
sp|Q9UVI4|THYD_CLAFS Trihydrophobin OS=Claviceps fusiformis GN=TH1 PE=1 SV=1 250 302 9.0E-06

GO

GO Term Description Terminal node
GO:0005576 extracellular region Yes
GO:0110165 cellular anatomical entity No
GO:0005575 cellular_component No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Extracellular Signal peptide 0.1244 0.0466 0.96 0.1467 0.1345 0.0123 0.0565 0.2155 0.0961 0.0029

SignalP

SignalP signal predicted Location Score
Yes 1 - 16 0.999785

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup136
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6106
Ophiocordyceps australis 1348a (Ghana) OphauG2|989
Ophiocordyceps australis map64 (Brazil) OphauB2|4594
Ophiocordyceps australis map64 (Brazil) OphauB2|5882
Ophiocordyceps camponoti-floridani Ophcf2|00473
Ophiocordyceps camponoti-rufipedis Ophun1|1213
Ophiocordyceps camponoti-rufipedis Ophun1|3829
Ophiocordyceps camponoti-rufipedis Ophun1|6587
Ophiocordyceps kimflemingae Ophio5|1277
Ophiocordyceps kimflemingae Ophio5|22 (this protein)
Ophiocordyceps subramaniannii Hirsu2|10919
Ophiocordyceps subramaniannii Hirsu2|1373
Ophiocordyceps subramaniannii Hirsu2|5330
Ophiocordyceps subramaniannii Hirsu2|640

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|22
MKFFAPAYLLLATALAAPHNGGYSTPSENTPASQEDSHHHNGDFSSHSGDYGMPKGGNGGMHGGNSGSGGYNIKN
DNGKGHHGGNGNGDYDIGGHGNNGDNDSGSGGYGNDDMSSHGNGHHGGNGDGGYGDGGFDNDAYDNDDNKKNNGN
KGWDNSNGGYGNGGYGKFGNGKFGNGKHGNSGNGNGNNGNGNGDNGNNGGNGNNGNGNGNGNSGNGNGNNGNGNG
GAAMPLCGGPSTGGLLGGLLESHEPRCCSIDVLGLADVSCEKPSGSPSSPSELKETCSKVGKEARCCALGLGNLA
DLICKPVA
Coding >Ophio5|22
ATGAAGTTCTTCGCCCCCGCCTACCTTCTCCTGGCTACTGCCCTGGCCGCTCCTCACAACGGAGGCTACAGCACG
CCTTCTGAGAACACGCCCGCAAGCCAAGAAGACAGCCACCACCACAATGGAGACTTCTCATCTCACAGCGGCGAC
TATGGGATGCCCAAAGGCGGAAACGGTGGCATGCACGGCGGAAACAGTGGCAGTGGTGGATACAACATCAAGAAC
GACAATGGAAAGGGTCATCACGGCGGCAATGGGAACGGTGACTATGACATTGGCGGCCATGGAAACAACGGCGAC
AACGACAGCGGCAGCGGCGGATATGGCAACGATGACATGAGCAGCCACGGAAACGGCCACCATGGCGGCAATGGA
GATGGCGGTTACGGCGATGGCGGCTTTGACAACGACGCATATGACAACGACGACAACAAGAAGAATAATGGAAAC
AAGGGCTGGGACAACAGCAATGGCGGCTACGGCAATGGCGGCTACGGCAAGTTTGGCAACGGCAAGTTTGGCAAC
GGCAAGCACGGAAATAGCGGGAACGGCAACGGTAACAACGGGAACGGCAACGGCGACAATGGCAATAATGGTGGC
AACGGCAACAATGGAAACGGCAACGGAAACGGCAATAGTGGAAACGGCAACGGCAACAATGGAAACGGCAACGGC
GGAGCTGCCATGCCCCTGTGCGGCGGTCCCTCCACCGGTGGACTTCTCGGAGGACTTCTCGAAAGCCACGAGCCT
CGCTGCTGCAGCATCGACGTGCTCGGCTTGGCGGACGTCAGCTGCGAGAAGCCATCTGGTTCGCCCTCGAGCCCT
TCGGAGCTCAAGGAGACGTGCTCAAAGGTCGGCAAGGAGGCTCGATGCTGCGCCCTGGGTCTGGGTAACCTTGCC
GACCTAATCTGCAAGCCCGTCGCC
Transcript >Ophio5|22
ATGAAGTTCTTCGCCCCCGCCTACCTTCTCCTGGCTACTGCCCTGGCCGCTCCTCACAACGGAGGCTACAGCACG
CCTTCTGAGAACACGCCCGCAAGCCAAGAAGACAGCCACCACCACAATGGAGACTTCTCATCTCACAGCGGCGAC
TATGGGATGCCCAAAGGCGGAAACGGTGGCATGCACGGCGGAAACAGTGGCAGTGGTGGATACAACATCAAGAAC
GACAATGGAAAGGGTCATCACGGCGGCAATGGGAACGGTGACTATGACATTGGCGGCCATGGAAACAACGGCGAC
AACGACAGCGGCAGCGGCGGATATGGCAACGATGACATGAGCAGCCACGGAAACGGCCACCATGGCGGCAATGGA
GATGGCGGTTACGGCGATGGCGGCTTTGACAACGACGCATATGACAACGACGACAACAAGAAGAATAATGGAAAC
AAGGGCTGGGACAACAGCAATGGCGGCTACGGCAATGGCGGCTACGGCAAGTTTGGCAACGGCAAGTTTGGCAAC
GGCAAGCACGGAAATAGCGGGAACGGCAACGGTAACAACGGGAACGGCAACGGCGACAATGGCAATAATGGTGGC
AACGGCAACAATGGAAACGGCAACGGAAACGGCAATAGTGGAAACGGCAACGGCAACAATGGAAACGGCAACGGC
GGAGCTGCCATGCCCCTGTGCGGCGGTCCCTCCACCGGTGGACTTCTCGGAGGACTTCTCGAAAGCCACGAGCCT
CGCTGCTGCAGCATCGACGTGCTCGGCTTGGCGGACGTCAGCTGCGAGAAGCCATCTGGTTCGCCCTCGAGCCCT
TCGGAGCTCAAGGAGACGTGCTCAAAGGTCGGCAAGGAGGCTCGATGCTGCGCCCTGGGTCTGGGTAACCTTGCC
GACCTAATCTGCAAGCCCGTCGCCTAA
Gene >Ophio5|22
ATGAAGTTCTTCGCCCCCGCCTACCTTCTCCTGGCTACTGCCCTGGCCGCTCCTCACAACGGAGGCTACAGCACG
CCTTCTGAGAACACGCCCGCAAGCCAAGAAGACAGCCACCACCACAATGGAGACTTCTCATCTCACAGCGGCGAC
TATGGGATGCCCAAAGGCGGAAACGGTGGCATGCACGGCGGAAACAGTGGCAGTGGTGGATACAACATCAAGAAC
GACAATGGAAAGGGTCATCACGGCGGCAATGGGAACGGTGACTATGACATTGGCGGCCATGGAAACAACGGCGAC
AACGACAGCGGCAGCGGCGGATATGGCAACGATGACATGAGCAGCCACGGAAACGGCCACCATGGCGGCAATGGA
GATGGCGGTTACGGCGATGGCGGCTTTGACAACGACGCATATGACAACGACGACAACAAGAAGAATAATGGAAAC
AAGGGCTGGGACAACAGCAATGGCGGCTACGGCAATGGCGGCTACGGCAAGTTTGGCAACGGCAAGTTTGGCAAC
GGCAAGCACGGAAATAGCGGGAACGGCAACGGTAACAACGGGAACGGCAACGGCGACAATGGCAATAATGGTGGC
AACGGCAACAATGGAAACGGCAACGGAAACGGCAATAGTGGAAACGGCAACGGCAACAATGGAAACGGCAACGGC
GGAGCTGCCATGCCCCTGTGCGGCGGTCCCTCCACCGGTGGACTTCTCGGAGGACTTCTCGAAAGCCACGAGCCT
CGCTGCTGCAGCATCGACGTGCTCGGCTTGGCGGACGTCAGCTGCGAGAAGCGTATGTGACCCATGCCTCATTAT
GATCTAGTCTGCTAACATGGACATAGCATCTGGTTCGCCCTCGAGCCCTTCGGAGCTCAAGGAGACGTGCTCAAA
GGTCGGCAAGGAGGCTCGATGCTGCGCCCTGGGTCTGGTAAGTCTCCCACCAACTGCTCAGTGACAGTGATAGCA
GAAGTTAATCAGACGACAGGGTAACCTTGCCGACCTAATCTGCAAGCCCGTCGCCTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail