Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|218
Gene name
Locationscaffold_104:21102..22265
Strand-
Gene length (bp)1163
Transcript length (bp)1041
Coding sequence length (bp)1038
Protein length (aa) 346

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05739 SNARE SNARE domain 1.5E-15 285 337

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9P6P1|TLG2_SCHPO t-SNARE affecting a late Golgi compartment protein 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tlg2 PE=3 SV=1 2 344 1.0E-62
sp|Q08144|TLG2_YEAST T-SNARE affecting a late Golgi compartment protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TLG2 PE=1 SV=1 1 342 1.0E-47
sp|Q9SUJ1|SYP43_ARATH Syntaxin-43 OS=Arabidopsis thaliana GN=SYP43 PE=2 SV=2 3 341 2.0E-34
sp|Q8BVI5|STX16_MOUSE Syntaxin-16 OS=Mus musculus GN=Stx16 PE=1 SV=3 74 320 7.0E-33
sp|O14662|STX16_HUMAN Syntaxin-16 OS=Homo sapiens GN=STX16 PE=1 SV=3 74 320 2.0E-31
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9P6P1|TLG2_SCHPO t-SNARE affecting a late Golgi compartment protein 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tlg2 PE=3 SV=1 2 344 1.0E-62
sp|Q08144|TLG2_YEAST T-SNARE affecting a late Golgi compartment protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TLG2 PE=1 SV=1 1 342 1.0E-47
sp|Q9SUJ1|SYP43_ARATH Syntaxin-43 OS=Arabidopsis thaliana GN=SYP43 PE=2 SV=2 3 341 2.0E-34
sp|Q8BVI5|STX16_MOUSE Syntaxin-16 OS=Mus musculus GN=Stx16 PE=1 SV=3 74 320 7.0E-33
sp|O14662|STX16_HUMAN Syntaxin-16 OS=Homo sapiens GN=STX16 PE=1 SV=3 74 320 2.0E-31
sp|O65359|SYP41_ARATH Syntaxin-41 OS=Arabidopsis thaliana GN=SYP41 PE=1 SV=1 3 341 8.0E-31
sp|Q9SWH4|SYP42_ARATH Syntaxin-42 OS=Arabidopsis thaliana GN=SYP42 PE=1 SV=1 3 341 3.0E-28
sp|O94651|PEP12_SCHPO Syntaxin pep12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pep12 PE=1 SV=2 251 340 4.0E-15
sp|O16000|STX1A_CAEEL Syntaxin-1A homolog OS=Caenorhabditis elegans GN=unc-64 PE=1 SV=1 49 343 2.0E-12
sp|O70439|STX7_MOUSE Syntaxin-7 OS=Mus musculus GN=Stx7 PE=1 SV=3 181 340 4.0E-11
sp|P32854|PEP12_YEAST Syntaxin PEP12 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PEP12 PE=1 SV=2 251 341 3.0E-10
sp|Q24547|STX1A_DROME Syntaxin-1A OS=Drosophila melanogaster GN=Syx1A PE=1 SV=1 207 335 1.0E-09
sp|P61265|STX1B_RAT Syntaxin-1B OS=Rattus norvegicus GN=Stx1b PE=1 SV=1 50 336 3.0E-09
sp|P61264|STX1B_MOUSE Syntaxin-1B OS=Mus musculus GN=Stx1b PE=1 SV=1 50 336 3.0E-09
sp|P61266|STX1B_HUMAN Syntaxin-1B OS=Homo sapiens GN=STX1B PE=1 SV=1 50 336 3.0E-09
sp|P61268|STX1B_SHEEP Syntaxin-1B OS=Ovis aries GN=STX1B PE=2 SV=1 50 336 3.0E-09
sp|P61267|STX1B_BOVIN Syntaxin-1B OS=Bos taurus GN=STX1B PE=1 SV=1 50 336 3.0E-09
sp|P32850|STX1A_BOVIN Syntaxin-1A OS=Bos taurus GN=STX1A PE=1 SV=1 224 336 7.0E-09
sp|Q5RBW6|STX12_PONAB Syntaxin-12 OS=Pongo abelii GN=STX12 PE=2 SV=1 251 329 8.0E-09
sp|P32851|STX1A_RAT Syntaxin-1A OS=Rattus norvegicus GN=Stx1a PE=1 SV=1 224 336 1.0E-08
sp|Q5R4L2|STX1A_PONAB Syntaxin-1A OS=Pongo abelii GN=STX1A PE=2 SV=1 224 336 1.0E-08
sp|O35526|STX1A_MOUSE Syntaxin-1A OS=Mus musculus GN=Stx1a PE=1 SV=3 224 336 2.0E-08
sp|Q16623|STX1A_HUMAN Syntaxin-1A OS=Homo sapiens GN=STX1A PE=1 SV=1 224 336 2.0E-08
sp|Q86Y82|STX12_HUMAN Syntaxin-12 OS=Homo sapiens GN=STX12 PE=1 SV=1 251 328 3.0E-08
sp|Q16932|STX_APLCA Syntaxin OS=Aplysia californica PE=2 SV=1 82 329 7.0E-08
sp|P93654|SYP22_ARATH Syntaxin-22 OS=Arabidopsis thaliana GN=SYP22 PE=1 SV=1 204 329 7.0E-08
sp|O15400|STX7_HUMAN Syntaxin-7 OS=Homo sapiens GN=STX7 PE=1 SV=4 181 320 3.0E-07
sp|Q5R602|STX7_PONAB Syntaxin-7 OS=Pongo abelii GN=STX7 PE=2 SV=3 181 320 4.0E-07
sp|Q3ZBT5|STX7_BOVIN Syntaxin-7 OS=Bos taurus GN=STX7 PE=2 SV=1 182 320 4.0E-07
sp|O70257|STX7_RAT Syntaxin-7 OS=Rattus norvegicus GN=Stx7 PE=1 SV=4 208 320 8.0E-07
sp|A8WVD0|STX1A_CAEBR Syntaxin-1A OS=Caenorhabditis briggsae GN=unc-64 PE=3 SV=1 50 322 1.0E-06
sp|Q54JY7|STX7A_DICDI Syntaxin-7A OS=Dictyostelium discoideum GN=syn7A PE=1 SV=1 249 340 1.0E-06
sp|Q20024|STX3_CAEEL Putative syntaxin-3 OS=Caenorhabditis elegans GN=syx-3 PE=3 SV=3 232 341 2.0E-06
sp|G3V7P1|STX12_RAT Syntaxin-12 OS=Rattus norvegicus GN=Stx12 PE=1 SV=1 251 321 2.0E-06
sp|Q9ER00|STX12_MOUSE Syntaxin-12 OS=Mus musculus GN=Stx12 PE=1 SV=1 251 321 6.0E-06
sp|Q01590|SED5_YEAST Integral membrane protein SED5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SED5 PE=1 SV=1 247 308 9.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 18 0.45

Transmembrane Domains

Domain # Start End Length
1 323 340 17

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|218
MWRDRTNLYLSYRQSYAHHPTQRRRTRAGGALGAFSNAYAGASSGYGDEDRSRLLSNDAFEDDGDAVIEMDLLPP
RWADVSDEVTELLTDIVTKSQRLEKLHQKHVLPRFDDDAAKKTEEAQIEKLTQEITKGFHECHKCIQRVEHMVRD
ARESGTLSHSEDIMARNIQISLATRVQDTSANFRKKQSAYLKKLRDMGGLGSFSPAERSSTPQLGSYLHPSLQES
DADKVFSQSALQAASQQKMLHSNDAVIAQREREIEDIAQGIIELSDLFRDLQTMVIDQGTLLDRIDYNVERTNED
VKGADKELKVASGYQRRTAKRKIILLLILLVAGLFILLLIKPKRQD
Coding >Ophio5|218
ATGTGGCGAGACCGCACCAACCTCTACCTCTCCTACCGCCAGTCGTACGCGCATCATCCTACACAGCGTAGAAGG
ACACGAGCAGGCGGCGCGTTAGGCGCCTTCTCCAACGCTTATGCCGGCGCCTCTTCCGGTTATGGAGACGAGGAT
CGCTCTCGTCTGCTATCGAACGACGCCTTCGAGGACGATGGCGATGCCGTTATCGAGATGGACCTGCTTCCGCCC
CGGTGGGCTGACGTCTCGGACGAGGTCACCGAGCTGCTCACCGACATCGTCACCAAGAGCCAGCGGCTAGAGAAG
CTGCATCAGAAACACGTCTTGCCCAGATTCGACGACGACGCCGCCAAGAAAACCGAAGAGGCGCAGATCGAGAAG
CTCACCCAAGAGATCACGAAAGGCTTTCATGAATGTCACAAATGCATCCAGCGTGTGGAGCACATGGTCCGCGAC
GCCAGGGAGTCGGGAACTCTCAGTCACTCTGAGGATATCATGGCGAGGAACATACAGATTTCCCTGGCCACCCGG
GTCCAAGACACTAGCGCCAACTTTCGCAAGAAGCAGAGCGCATACCTCAAGAAGCTTCGCGACATGGGCGGCTTG
GGGTCCTTCAGTCCGGCCGAGCGGTCATCCACACCGCAACTGGGCTCTTATTTGCACCCTTCGCTGCAGGAGTCC
GACGCCGACAAGGTCTTCTCTCAGTCTGCGTTGCAGGCGGCCTCGCAGCAAAAGATGCTTCACTCTAACGACGCC
GTCATCGCGCAAAGAGAACGCGAGATAGAAGACATTGCTCAGGGCATCATTGAGCTGTCGGACCTGTTCCGCGAC
CTTCAAACAATGGTCATAGACCAAGGGACCTTGCTGGACAGGATCGACTACAACGTAGAACGGACGAACGAGGAT
GTCAAGGGCGCCGACAAGGAGCTCAAGGTCGCGTCGGGATACCAGAGAAGAACGGCCAAACGAAAGATCATCCTT
CTGCTCATACTTTTGGTCGCCGGTCTCTTCATTCTTTTATTAATCAAACCGAAGAGGCAAGAT
Transcript >Ophio5|218
ATGTGGCGAGACCGCACCAACCTCTACCTCTCCTACCGCCAGTCGTACGCGCATCATCCTACACAGCGTAGAAGG
ACACGAGCAGGCGGCGCGTTAGGCGCCTTCTCCAACGCTTATGCCGGCGCCTCTTCCGGTTATGGAGACGAGGAT
CGCTCTCGTCTGCTATCGAACGACGCCTTCGAGGACGATGGCGATGCCGTTATCGAGATGGACCTGCTTCCGCCC
CGGTGGGCTGACGTCTCGGACGAGGTCACCGAGCTGCTCACCGACATCGTCACCAAGAGCCAGCGGCTAGAGAAG
CTGCATCAGAAACACGTCTTGCCCAGATTCGACGACGACGCCGCCAAGAAAACCGAAGAGGCGCAGATCGAGAAG
CTCACCCAAGAGATCACGAAAGGCTTTCATGAATGTCACAAATGCATCCAGCGTGTGGAGCACATGGTCCGCGAC
GCCAGGGAGTCGGGAACTCTCAGTCACTCTGAGGATATCATGGCGAGGAACATACAGATTTCCCTGGCCACCCGG
GTCCAAGACACTAGCGCCAACTTTCGCAAGAAGCAGAGCGCATACCTCAAGAAGCTTCGCGACATGGGCGGCTTG
GGGTCCTTCAGTCCGGCCGAGCGGTCATCCACACCGCAACTGGGCTCTTATTTGCACCCTTCGCTGCAGGAGTCC
GACGCCGACAAGGTCTTCTCTCAGTCTGCGTTGCAGGCGGCCTCGCAGCAAAAGATGCTTCACTCTAACGACGCC
GTCATCGCGCAAAGAGAACGCGAGATAGAAGACATTGCTCAGGGCATCATTGAGCTGTCGGACCTGTTCCGCGAC
CTTCAAACAATGGTCATAGACCAAGGGACCTTGCTGGACAGGATCGACTACAACGTAGAACGGACGAACGAGGAT
GTCAAGGGCGCCGACAAGGAGCTCAAGGTCGCGTCGGGATACCAGAGAAGAACGGCCAAACGAAAGATCATCCTT
CTGCTCATACTTTTGGTCGCCGGTCTCTTCATTCTTTTATTAATCAAACCGAAGAGGCAAGATTGA
Gene >Ophio5|218
ATGTGGCGAGACCGCACCAACCTGTCCGTCCCGTCTCCTCACTCATTACCCAAGCGGCTCACAAGCAGCTGACAT
GGCCACCGTCAAAGCTACCTCTCCTACCGCCAGTCGTACGCGCATCATCCTACACAGCGTAGAAGGACACGAGCA
GGCGGCGCGTTAGGCGCCTTCTCCAACGCTTATGCCGGCGCCTCTTCCGGTTATGGAGACGAGGATCGCTCTCGT
CTGCTATCGAACGACGCCTTCGAGGACGATGGCGATGCCGTTATCGAGATGGACCTGCTTCCGCCCCGGTGGGCT
GACGTCTCGGACGAGGTCACCGAGCTGCTCACCGACATCGTCACCAAGAGCCAGCGGCTAGAGAAGCTGCATCAG
AAACACGTCTTGCCCAGATTCGACGACGACGCCGCCAAGAAAACCGAAGAGGCGCAGATCGAGAAGCTCACCCAA
GAGATCACGAAAGGCTTTCATGAATGTCACAAATGCATCCAGCGTGTGGAGCACATGGTCCGCGACGCCAGGGAG
TCGGGAACTCTCAGTCACTCTGAGGATATCATGGCGAGGAACATACAGATTTCCCTGGCCACCCGGGTCCAAGAC
ACTAGCGCCAACTTTCGCAAGAAGCAGAGCGCATACCTCAAGAGTATGTTGAACGGTGTCCTGACCCCTACTCGT
CTTCCACTCACGCCCTTTTCCTAGAGCTTCGCGACATGGGCGGCTTGGGGTCCTTCAGTCCGGCCGAGCGGTCAT
CCACACCGCAACTGGGCTCTTATTTGCACCCTTCGCTGCAGGAGTCCGACGCCGACAAGGTCTTCTCTCAGTCTG
CGTTGCAGGCGGCCTCGCAGCAAAAGATGCTTCACTCTAACGACGCCGTCATCGCGCAAAGAGAACGCGAGATAG
AAGACATTGCTCAGGGCATCATTGAGCTGTCGGACCTGTTCCGCGACCTTCAAACAATGGTCATAGACCAAGGGA
CCTTGCTGGACAGGATCGACTACAACGTAGAACGGACGAACGAGGATGTCAAGGGCGCCGACAAGGAGCTCAAGG
TCGCGTCGGGATACCAGAGAAGAACGGCCAAACGAAAGATCATCCTTCTGCTCATACTTTTGGTCGCCGGTCTCT
TCATTCTTTTATTAATCAAACCGAAGAGGCAAGATTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail