Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|2165
Gene name
Locationscaffold_19:5576..7822
Strand-
Gene length (bp)2246
Transcript length (bp)2136
Coding sequence length (bp)2133
Protein length (aa) 711

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF06862 UTP25 Utp25, U3 small nucleolar RNA-associated SSU processome protein 25 1.8E-191 236 710

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|D4DB32|UTP25_TRIVH U3 small nucleolar RNA-associated protein 25 OS=Trichophyton verrucosum (strain HKI 0517) GN=UTP25 PE=3 SV=1 19 710 0.0E+00
sp|C1G2D1|UTP25_PARBD U3 small nucleolar RNA-associated protein 25 OS=Paracoccidioides brasiliensis (strain Pb18) GN=UTP25 PE=3 SV=1 76 710 0.0E+00
sp|Q5BDM6|UTP25_EMENI U3 small nucleolar RNA-associated protein 25 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=utp25 PE=3 SV=2 71 710 0.0E+00
sp|A1D3E2|UTP25_NEOFI U3 small nucleolar RNA-associated protein 25 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=utp25 PE=3 SV=1 20 710 0.0E+00
sp|C1GPD0|UTP25_PARBA U3 small nucleolar RNA-associated protein 25 OS=Paracoccidioides lutzii (strain ATCC MYA-826 / Pb01) GN=UTP25 PE=3 SV=2 76 710 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|D4DB32|UTP25_TRIVH U3 small nucleolar RNA-associated protein 25 OS=Trichophyton verrucosum (strain HKI 0517) GN=UTP25 PE=3 SV=1 19 710 0.0E+00
sp|C1G2D1|UTP25_PARBD U3 small nucleolar RNA-associated protein 25 OS=Paracoccidioides brasiliensis (strain Pb18) GN=UTP25 PE=3 SV=1 76 710 0.0E+00
sp|Q5BDM6|UTP25_EMENI U3 small nucleolar RNA-associated protein 25 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=utp25 PE=3 SV=2 71 710 0.0E+00
sp|A1D3E2|UTP25_NEOFI U3 small nucleolar RNA-associated protein 25 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=utp25 PE=3 SV=1 20 710 0.0E+00
sp|C1GPD0|UTP25_PARBA U3 small nucleolar RNA-associated protein 25 OS=Paracoccidioides lutzii (strain ATCC MYA-826 / Pb01) GN=UTP25 PE=3 SV=2 76 710 0.0E+00
sp|A1CQH8|UTP25_ASPCL U3 small nucleolar RNA-associated protein 25 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=utp25 PE=3 SV=1 54 710 0.0E+00
sp|Q0CCM6|UTP25_ASPTN U3 small nucleolar RNA-associated protein 25 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=utp25 PE=3 SV=1 3 710 0.0E+00
sp|C6HQ17|UTP25_AJECH U3 small nucleolar RNA-associated protein 25 OS=Ajellomyces capsulatus (strain H143) GN=UTP25 PE=3 SV=2 3 710 0.0E+00
sp|Q4WTH1|UTP25_ASPFU U3 small nucleolar RNA-associated protein 25 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=utp25 PE=3 SV=1 71 710 0.0E+00
sp|B0XQ54|UTP25_ASPFC U3 small nucleolar RNA-associated protein 25 OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=utp25 PE=3 SV=1 71 710 0.0E+00
sp|E3QBI3|UTP25_COLGM U3 small nucleolar RNA-associated protein 25 OS=Colletotrichum graminicola (strain M1.001 / M2 / FGSC 10212) GN=UTP25 PE=3 SV=1 49 710 0.0E+00
sp|D4AUV1|UTP25_ARTBC U3 small nucleolar RNA-associated protein 25 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=UTP25 PE=3 SV=1 16 710 0.0E+00
sp|C5G0N1|UTP25_ARTOC U3 small nucleolar RNA-associated protein 25 OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=UTP25 PE=3 SV=1 6 710 0.0E+00
sp|E4V6L3|UTP25_ARTGP U3 small nucleolar RNA-associated protein 25 OS=Arthroderma gypseum (strain ATCC MYA-4604 / CBS 118893) GN=UTP25 PE=3 SV=1 6 710 0.0E+00
sp|B2W0B1|UTP25_PYRTR U3 small nucleolar RNA-associated protein 25 OS=Pyrenophora tritici-repentis (strain Pt-1C-BFP) GN=utp25 PE=3 SV=1 72 710 0.0E+00
sp|C0NQU6|UTP25_AJECG U3 small nucleolar RNA-associated protein 25 OS=Ajellomyces capsulatus (strain G186AR / H82 / ATCC MYA-2454 / RMSCC 2432) GN=UTP25 PE=3 SV=1 3 694 0.0E+00
sp|E3REX5|UTP25_PYRTT U3 small nucleolar RNA-associated protein 25 OS=Pyrenophora teres f. teres (strain 0-1) GN=utp25 PE=3 SV=1 72 710 0.0E+00
sp|Q0UTQ5|UTP25_PHANO U3 small nucleolar RNA-associated protein 25 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=UTP25 PE=3 SV=2 69 710 0.0E+00
sp|E5R5D9|UTP25_LEPMJ U3 small nucleolar RNA-associated protein 25 OS=Leptosphaeria maculans (strain JN3 / isolate v23.1.3 / race Av1-4-5-6-7-8) GN=UTP25 PE=3 SV=1 149 710 0.0E+00
sp|D1Z6B1|UTP25_SORMK U3 small nucleolar RNA-associated protein 25 OS=Sordaria macrospora (strain ATCC MYA-333 / DSM 997 / K(L3346) / K-hell) GN=UTP25 PE=3 SV=1 27 710 0.0E+00
sp|Q2UPL9|UTP25_ASPOR U3 small nucleolar RNA-associated protein 25 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=utp25 PE=3 SV=1 146 710 0.0E+00
sp|C7YRJ1|UTP25_NECH7 U3 small nucleolar RNA-associated protein 25 OS=Nectria haematococca (strain 77-13-4 / ATCC MYA-4622 / FGSC 9596 / MPVI) GN=UTP25 PE=3 SV=1 23 710 0.0E+00
sp|A4R0E6|UTP25_MAGO7 U3 small nucleolar RNA-associated protein 25 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=UTP25 PE=3 SV=2 62 710 0.0E+00
sp|Q9P749|UTP25_NEUCR U3 small nucleolar RNA-associated protein 25 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=utp25 PE=3 SV=2 72 710 0.0E+00
sp|B2B4I8|UTP25_PODAN U3 small nucleolar RNA-associated protein 25 OS=Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) GN=UTP25 PE=3 SV=1 65 710 0.0E+00
sp|Q2HGJ1|UTP25_CHAGB U3 small nucleolar RNA-associated protein 25 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=UTP25 PE=3 SV=1 59 710 0.0E+00
sp|A7EZP8|UTP25_SCLS1 U3 small nucleolar RNA-associated protein 25 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=utp25 PE=3 SV=1 77 710 0.0E+00
sp|A6RT94|UTP25_BOTFB U3 small nucleolar RNA-associated protein 25 OS=Botryotinia fuckeliana (strain B05.10) GN=UTP25 PE=3 SV=1 77 710 0.0E+00
sp|B6Q702|UTP25_TALMQ U3 small nucleolar RNA-associated protein 25 OS=Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333) GN=utp25 PE=3 SV=1 45 710 0.0E+00
sp|B8LVD6|UTP25_TALSN U3 small nucleolar RNA-associated protein 25 OS=Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006) GN=utp25 PE=3 SV=1 9 710 0.0E+00
sp|C5JMX0|UTP25_AJEDS U3 small nucleolar RNA-associated protein 25 OS=Ajellomyces dermatitidis (strain SLH14081) GN=UTP25 PE=3 SV=1 71 710 0.0E+00
sp|C5GAH0|UTP25_AJEDR U3 small nucleolar RNA-associated protein 25 OS=Ajellomyces dermatitidis (strain ER-3 / ATCC MYA-2586) GN=UTP25 PE=3 SV=1 71 710 0.0E+00
sp|B6H768|UTP25_PENRW U3 small nucleolar RNA-associated protein 25 OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) GN=utp25 PE=3 SV=1 33 710 0.0E+00
sp|C4JTH6|UTP25_UNCRE U3 small nucleolar RNA-associated protein 25 OS=Uncinocarpus reesii (strain UAMH 1704) GN=UTP25 PE=3 SV=1 16 710 0.0E+00
sp|C5P5Z4|UTP25_COCP7 U3 small nucleolar RNA-associated protein 25 OS=Coccidioides posadasii (strain C735) GN=UTP25 PE=3 SV=1 54 710 0.0E+00
sp|A2QQ09|UTP25_ASPNC U3 small nucleolar RNA-associated protein 25 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=utp25 PE=3 SV=1 10 710 0.0E+00
sp|C0SG20|UTP25_PARBP U3 small nucleolar RNA-associated protein 25 OS=Paracoccidioides brasiliensis (strain Pb03) GN=UTP25 PE=3 SV=1 76 710 0.0E+00
sp|B6JX19|UTP25_SCHJY U3 small nucleolar RNA-associated protein 25 OS=Schizosaccharomyces japonicus (strain yFS275 / FY16936) GN=utp25 PE=3 SV=1 144 710 5.0E-162
sp|O74974|UTP25_SCHPO U3 small nucleolar RNA-associated protein 25 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=utp25 PE=3 SV=1 138 710 2.0E-159
sp|C5M3P0|UTP25_CANTT U3 small nucleolar RNA-associated protein 25 OS=Candida tropicalis (strain ATCC MYA-3404 / T1) GN=UTP25 PE=3 SV=1 9 710 3.0E-148
sp|B9WM88|UTP25_CANDC U3 small nucleolar RNA-associated protein 25 OS=Candida dubliniensis (strain CD36 / ATCC MYA-646 / CBS 7987 / NCPF 3949 / NRRL Y-17841) GN=UTP25 PE=3 SV=1 77 710 4.0E-144
sp|Q59MU1|UTP25_CANAL U3 small nucleolar RNA-associated protein 25 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=UTP25 PE=3 SV=1 154 710 1.0E-139
sp|C4YMA4|UTP25_CANAW U3 small nucleolar RNA-associated protein 25 OS=Candida albicans (strain WO-1) GN=UTP25 PE=3 SV=1 154 710 3.0E-139
sp|Q6BYC4|UTP25_DEBHA U3 small nucleolar RNA-associated protein 25 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=UTP25 PE=3 SV=2 214 710 3.0E-137
sp|A5E1F6|UTP25_LODEL U3 small nucleolar RNA-associated protein 25 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=UTP25 PE=3 SV=1 156 710 3.0E-135
sp|C4XWY8|UTP25_CLAL4 U3 small nucleolar RNA-associated protein 25 OS=Clavispora lusitaniae (strain ATCC 42720) GN=UTP25 PE=3 SV=1 156 710 8.0E-134
sp|A5DFC2|UTP25_PICGU U3 small nucleolar RNA-associated protein 25 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=UTP25 PE=3 SV=2 56 710 2.0E-131
sp|P40498|UTP25_YEAST U3 small nucleolar RNA-associated protein 25 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=UTP25 PE=1 SV=1 13 710 6.0E-128
sp|A6ZVI6|UTP25_YEAS7 U3 small nucleolar RNA-associated protein 25 OS=Saccharomyces cerevisiae (strain YJM789) GN=UTP25 PE=3 SV=1 13 710 7.0E-127
sp|C7GKL8|UTP25_YEAS2 U3 small nucleolar RNA-associated protein 25 OS=Saccharomyces cerevisiae (strain JAY291) GN=UTP25 PE=3 SV=1 13 710 7.0E-127
sp|B3LTT8|UTP25_YEAS1 U3 small nucleolar RNA-associated protein 25 OS=Saccharomyces cerevisiae (strain RM11-1a) GN=UTP25 PE=3 SV=1 13 710 7.0E-127
sp|C8ZAF8|UTP25_YEAS8 U3 small nucleolar RNA-associated protein 25 OS=Saccharomyces cerevisiae (strain Lalvin EC1118 / Prise de mousse) GN=UTP25 PE=3 SV=1 13 710 8.0E-127
sp|Q6CP18|UTP25_KLULA U3 small nucleolar RNA-associated protein 25 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=UTP25 PE=3 SV=1 46 710 1.0E-126
sp|Q6CAC9|UTP25_YARLI U3 small nucleolar RNA-associated protein 25 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=UTP25 PE=3 SV=1 156 711 1.0E-124
sp|Q75AX9|UTP25_ASHGO U3 small nucleolar RNA-associated protein 25 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=UTP25 PE=3 SV=1 14 710 5.0E-124
sp|A3LXV1|UTP25_PICST U3 small nucleolar RNA-associated protein 25 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=UTP25 PE=3 SV=2 240 710 3.0E-123
sp|C5DMP2|UTP25_LACTC U3 small nucleolar RNA-associated protein 25 OS=Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284) GN=UTP25 PE=3 SV=1 123 710 3.0E-121
sp|Q6FVZ6|UTP25_CANGA U3 small nucleolar RNA-associated protein 25 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=UTP25 PE=3 SV=1 149 710 6.0E-121
sp|C5DPB7|UTP25_ZYGRC U3 small nucleolar RNA-associated protein 25 OS=Zygosaccharomyces rouxii (strain ATCC 2623 / CBS 732 / NBRC 1130 / NCYC 568 / NRRL Y-229) GN=UTP25 PE=3 SV=1 40 710 3.0E-120
sp|A7THH1|UTP25_VANPO U3 small nucleolar RNA-associated protein 25 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=UTP25 PE=3 SV=1 196 710 3.0E-117
sp|Q6PEH4|DIEXF_DANRE Digestive organ expansion factor OS=Danio rerio GN=diexf PE=2 SV=2 234 710 5.0E-115
sp|C4R2K0|UTP25_PICPG U3 small nucleolar RNA-associated protein 25 OS=Komagataella pastoris (strain GS115 / ATCC 20864) GN=UTP25 PE=3 SV=1 144 710 9.0E-113
sp|Q642T7|DIEXF_XENTR Digestive organ expansion factor homolog OS=Xenopus tropicalis GN=diexf PE=2 SV=1 238 710 4.0E-108
sp|Q8BTT6|DIEXF_MOUSE Digestive organ expansion factor homolog OS=Mus musculus GN=Diexf PE=2 SV=2 144 702 1.0E-106
sp|Q68CQ4|DIEXF_HUMAN Digestive organ expansion factor homolog OS=Homo sapiens GN=DIEXF PE=1 SV=2 129 710 1.0E-106
sp|Q5M9G7|DIEXF_RAT Digestive organ expansion factor homolog OS=Rattus norvegicus GN=Diexf PE=2 SV=1 148 702 6.0E-106
sp|Q5ZLG3|DIEXF_CHICK Digestive organ expansion factor homolog OS=Gallus gallus GN=DIEXF PE=2 SV=1 238 710 5.0E-104
[Show less]

GO

GO Term Description Terminal node
GO:0006364 rRNA processing Yes
GO:0005730 nucleolus Yes
GO:0034511 U3 snoRNA binding Yes
GO:0046483 heterocycle metabolic process No
GO:0071704 organic substance metabolic process No
GO:0003674 molecular_function No
GO:0044237 cellular metabolic process No
GO:0008152 metabolic process No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0043226 organelle No
GO:0043170 macromolecule metabolic process No
GO:0003676 nucleic acid binding No
GO:0090304 nucleic acid metabolic process No
GO:0044238 primary metabolic process No
GO:0043228 non-membrane-bounded organelle No
GO:0043232 intracellular non-membrane-bounded organelle No
GO:0006725 cellular aromatic compound metabolic process No
GO:0008150 biological_process No
GO:1901360 organic cyclic compound metabolic process No
GO:0110165 cellular anatomical entity No
GO:0005488 binding No
GO:0034470 ncRNA processing No
GO:0009987 cellular process No
GO:1901363 heterocyclic compound binding No
GO:0030515 snoRNA binding No
GO:0043229 intracellular organelle No
GO:0005575 cellular_component No
GO:0016070 RNA metabolic process No
GO:0006396 RNA processing No
GO:0097159 organic cyclic compound binding No
GO:0016072 rRNA metabolic process No
GO:0003723 RNA binding No
GO:0006807 nitrogen compound metabolic process No
GO:0034660 ncRNA metabolic process No
GO:0034641 cellular nitrogen compound metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|2165
MNPRARGGKPRGRGFRGRGRGRGSSRFGPTRPFHGGRLADKEPEEPDVESGSGDATDDEVGSTASDEGDEKQPSH
PYQALLQSFHDAAPKAKRRKLEHEGTPGKSLNSPPSRTEEDPGPEVEHDDVDRAEEEGEDDGIDTEPHDVSDSEN
EDDSPDPFDVHFARPDEASVSKAIEAVTHGQWATKRAPIQPLRATLMSPGSEARFDALAPISQLDGLRLKQKLKQ
TAAKQLGTLDESQRVLAPLLFDYLDVLYCDRTVTNSDSLRRLVCLHALNHAFKTRDRVIKNNYKLAKEGEDTELE
FRDQGFTRPKVLFLLPTRNSCARVMHAIQDLCEADQLENRKRFEASYVDRSSSFREDRPADFIDLFEGNDDDMFR
IGVKFTRKTIKYFAQFYNSDLLLASPLGLRMAMGSEEDRGKPDMDFLSSIEIVVMDQADALLMQNWDHVEHIFEH
LNRQPGDAHGCDFSRLRSWYLDDQAKFYRQTVVLSAFNTPELSELLRQHCHNWAGKARLQPEYGGVIQQLGIKAK
QTFSRFQPASVEQEPDARFEYFVSAIVPTLVKRAKHSNGLLLFVPSYLDFVRVRNYFANSVDVSSVSFGAISEYS
EVADASRACSHFASGRHRLLLYTERAHHFRRYRIRGVHKVIFYGLPDNPVFYREVAGEFLSRSEQDLSIEVGQGT
VRVMYSKFDAMKLERVAGSARVGKMLQERGDTFDFY
Coding >Ophio5|2165
ATGAATCCTCGCGCAAGGGGTGGAAAACCCCGTGGGCGTGGCTTTCGAGGCCGGGGCAGGGGCCGAGGATCGAGT
CGCTTTGGTCCTACGCGGCCATTTCATGGCGGCCGGCTAGCAGACAAGGAACCCGAAGAACCCGACGTGGAGAGC
GGCTCCGGCGATGCGACCGATGATGAAGTGGGCTCGACTGCTTCCGATGAAGGGGACGAGAAGCAGCCTTCACAT
CCGTACCAGGCTCTCCTTCAGAGCTTCCACGACGCCGCTCCCAAGGCCAAGAGGCGGAAGCTAGAGCATGAAGGC
ACTCCTGGAAAATCTCTAAATTCTCCGCCTTCTCGGACGGAAGAGGACCCTGGGCCTGAGGTGGAACATGATGAT
GTCGATAGGGCTGAAGAAGAGGGGGAAGACGACGGAATCGATACTGAACCCCACGACGTCTCGGACTCTGAAAAC
GAGGACGATTCACCAGATCCATTTGACGTCCACTTCGCTCGTCCGGATGAAGCGAGCGTGTCGAAGGCCATCGAA
GCGGTCACGCACGGGCAATGGGCTACAAAGCGAGCGCCCATTCAACCGCTGAGGGCCACGCTGATGTCTCCGGGA
TCGGAAGCGCGTTTCGATGCTCTAGCACCAATTTCTCAACTCGACGGCCTGAGACTCAAGCAAAAGCTTAAACAG
ACCGCTGCCAAGCAACTGGGCACTCTCGATGAAAGTCAGCGAGTGCTCGCGCCCCTGCTCTTTGACTATCTAGAC
GTGCTATACTGCGACCGTACGGTGACCAACTCCGACAGCCTCAGACGCTTGGTCTGTCTTCACGCGCTCAACCAC
GCCTTCAAGACCCGAGACCGCGTCATCAAGAACAATTACAAGCTCGCAAAGGAGGGCGAGGATACGGAACTCGAG
TTTCGAGATCAGGGCTTCACCCGCCCCAAGGTGCTGTTCCTCCTGCCGACCAGGAATTCGTGTGCTCGTGTGATG
CACGCCATCCAAGACCTATGCGAAGCGGACCAGCTGGAGAACCGTAAGCGGTTCGAGGCCTCTTACGTGGACAGG
AGCTCGAGCTTCAGAGAAGACCGGCCGGCCGACTTTATAGACCTGTTCGAGGGCAACGACGATGACATGTTCCGC
ATCGGAGTCAAATTCACGCGCAAGACCATCAAATACTTTGCCCAGTTCTACAACTCGGACTTGCTGTTAGCCAGT
CCGCTGGGCCTGCGAATGGCGATGGGTTCCGAGGAGGACAGGGGAAAGCCAGACATGGACTTTCTCAGCTCGATC
GAGATTGTCGTCATGGACCAGGCCGACGCTCTTCTGATGCAGAACTGGGACCACGTGGAGCACATCTTCGAGCAC
CTGAATCGGCAGCCAGGGGACGCTCACGGCTGTGACTTCAGCCGGCTGAGGAGCTGGTACCTCGACGACCAGGCC
AAGTTCTACAGGCAGACGGTGGTGTTGTCGGCCTTTAACACGCCCGAGCTGTCGGAGCTGCTGCGGCAACACTGC
CACAACTGGGCCGGCAAGGCGCGGCTTCAGCCGGAGTATGGCGGCGTTATCCAGCAGTTGGGCATCAAGGCGAAG
CAGACCTTTTCGCGCTTTCAGCCGGCGTCGGTGGAGCAGGAACCCGACGCCCGGTTCGAATACTTTGTCTCTGCC
ATCGTGCCGACGCTGGTCAAGCGGGCCAAGCACTCGAACGGCTTGCTGCTGTTCGTGCCTTCGTATCTCGACTTC
GTCCGGGTGCGCAACTACTTTGCCAACTCGGTCGACGTCAGCAGCGTCTCGTTTGGAGCCATCTCCGAGTACAGC
GAGGTGGCAGACGCCTCGCGCGCGTGCTCGCACTTTGCGTCGGGCCGGCACCGCCTTCTCCTGTACACGGAGCGA
GCGCATCACTTTCGGCGATATCGCATCAGGGGCGTGCACAAAGTCATCTTCTACGGCCTGCCGGACAACCCCGTC
TTTTACCGCGAGGTGGCGGGCGAGTTTTTGAGTCGGAGCGAGCAGGATCTGAGCATCGAGGTCGGGCAGGGGACG
GTGAGGGTCATGTACTCGAAGTTTGACGCGATGAAACTGGAGAGGGTTGCCGGGTCTGCGAGGGTTGGCAAGATG
CTACAGGAGCGCGGTGATACGTTTGACTTTTAT
Transcript >Ophio5|2165
ATGAATCCTCGCGCAAGGGGTGGAAAACCCCGTGGGCGTGGCTTTCGAGGCCGGGGCAGGGGCCGAGGATCGAGT
CGCTTTGGTCCTACGCGGCCATTTCATGGCGGCCGGCTAGCAGACAAGGAACCCGAAGAACCCGACGTGGAGAGC
GGCTCCGGCGATGCGACCGATGATGAAGTGGGCTCGACTGCTTCCGATGAAGGGGACGAGAAGCAGCCTTCACAT
CCGTACCAGGCTCTCCTTCAGAGCTTCCACGACGCCGCTCCCAAGGCCAAGAGGCGGAAGCTAGAGCATGAAGGC
ACTCCTGGAAAATCTCTAAATTCTCCGCCTTCTCGGACGGAAGAGGACCCTGGGCCTGAGGTGGAACATGATGAT
GTCGATAGGGCTGAAGAAGAGGGGGAAGACGACGGAATCGATACTGAACCCCACGACGTCTCGGACTCTGAAAAC
GAGGACGATTCACCAGATCCATTTGACGTCCACTTCGCTCGTCCGGATGAAGCGAGCGTGTCGAAGGCCATCGAA
GCGGTCACGCACGGGCAATGGGCTACAAAGCGAGCGCCCATTCAACCGCTGAGGGCCACGCTGATGTCTCCGGGA
TCGGAAGCGCGTTTCGATGCTCTAGCACCAATTTCTCAACTCGACGGCCTGAGACTCAAGCAAAAGCTTAAACAG
ACCGCTGCCAAGCAACTGGGCACTCTCGATGAAAGTCAGCGAGTGCTCGCGCCCCTGCTCTTTGACTATCTAGAC
GTGCTATACTGCGACCGTACGGTGACCAACTCCGACAGCCTCAGACGCTTGGTCTGTCTTCACGCGCTCAACCAC
GCCTTCAAGACCCGAGACCGCGTCATCAAGAACAATTACAAGCTCGCAAAGGAGGGCGAGGATACGGAACTCGAG
TTTCGAGATCAGGGCTTCACCCGCCCCAAGGTGCTGTTCCTCCTGCCGACCAGGAATTCGTGTGCTCGTGTGATG
CACGCCATCCAAGACCTATGCGAAGCGGACCAGCTGGAGAACCGTAAGCGGTTCGAGGCCTCTTACGTGGACAGG
AGCTCGAGCTTCAGAGAAGACCGGCCGGCCGACTTTATAGACCTGTTCGAGGGCAACGACGATGACATGTTCCGC
ATCGGAGTCAAATTCACGCGCAAGACCATCAAATACTTTGCCCAGTTCTACAACTCGGACTTGCTGTTAGCCAGT
CCGCTGGGCCTGCGAATGGCGATGGGTTCCGAGGAGGACAGGGGAAAGCCAGACATGGACTTTCTCAGCTCGATC
GAGATTGTCGTCATGGACCAGGCCGACGCTCTTCTGATGCAGAACTGGGACCACGTGGAGCACATCTTCGAGCAC
CTGAATCGGCAGCCAGGGGACGCTCACGGCTGTGACTTCAGCCGGCTGAGGAGCTGGTACCTCGACGACCAGGCC
AAGTTCTACAGGCAGACGGTGGTGTTGTCGGCCTTTAACACGCCCGAGCTGTCGGAGCTGCTGCGGCAACACTGC
CACAACTGGGCCGGCAAGGCGCGGCTTCAGCCGGAGTATGGCGGCGTTATCCAGCAGTTGGGCATCAAGGCGAAG
CAGACCTTTTCGCGCTTTCAGCCGGCGTCGGTGGAGCAGGAACCCGACGCCCGGTTCGAATACTTTGTCTCTGCC
ATCGTGCCGACGCTGGTCAAGCGGGCCAAGCACTCGAACGGCTTGCTGCTGTTCGTGCCTTCGTATCTCGACTTC
GTCCGGGTGCGCAACTACTTTGCCAACTCGGTCGACGTCAGCAGCGTCTCGTTTGGAGCCATCTCCGAGTACAGC
GAGGTGGCAGACGCCTCGCGCGCGTGCTCGCACTTTGCGTCGGGCCGGCACCGCCTTCTCCTGTACACGGAGCGA
GCGCATCACTTTCGGCGATATCGCATCAGGGGCGTGCACAAAGTCATCTTCTACGGCCTGCCGGACAACCCCGTC
TTTTACCGCGAGGTGGCGGGCGAGTTTTTGAGTCGGAGCGAGCAGGATCTGAGCATCGAGGTCGGGCAGGGGACG
GTGAGGGTCATGTACTCGAAGTTTGACGCGATGAAACTGGAGAGGGTTGCCGGGTCTGCGAGGGTTGGCAAGATG
CTACAGGAGCGCGGTGATACGTTTGACTTTTATTGA
Gene >Ophio5|2165
ATGAATCCTCGCGCAAGGGGTGGAAAACCCCGTGGGCGTGGCTTTCGAGGCCGGGGCAGGGGCCGAGGATCGAGT
CGCTTTGGTCCTACGCGGCCATTTCATGGCGGCCGGCTAGCAGACAAGGAGTTCGTTGAGAAGCCAGTTGCGGTT
CATCATGATGCTTACGTTCTCTCTGGCAGACCCGAAGAACCCGACGTGGAGAGCGGCTCCGGCGATGCGACCGAT
GATGAAGTGGGCTCGACTGCTTCCGATGAAGGGGACGAGAAGCAGCCTTCACATCCGTACCAGGCTCTCCTTCAG
AGCTTCCACGACGCCGCTCCCAAGGCCAAGAGGCGGAAGCTAGAGCATGAAGGCACTCCTGGAAAATCTCTAAAT
TCTCCGCCTTCTCGGACGGAAGAGGACCCTGGGCCTGAGGTGGAACATGATGATGTCGATAGGGCTGAAGAAGAG
GGGGAAGACGACGGAATCGATACTGAACCCCACGACGTCTCGGACTCTGAAAACGAGGACGATTCACCAGATCCA
TTTGACGTCCACTTCGCTCGTCCGGATGAAGCGAGCGTGTCGAAGGCCATCGAAGCGGTCACGCACGGGCAATGG
GCTACAAAGCGAGCGCCCATTCAACCGCTGAGGGCCACGCTGATGTCTCCGGGATCGGAAGCGCGTTTCGATGCT
CTAGCACCAATTTCTCAACTCGACGGCCTGAGACTCAAGCAAAAGCTTAAACAGACCGCTGCCAAGCAACTGGGC
ACTCTCGATGAAAGTCAGCGAGTGCTCGCGCCCCTGCTCTTTGACTATCTAGACGTGCTATACTGCGACCGTACG
GTGACCAACTCCGACAGCCTCAGACGCTTGGTCTGTCTTCACGCGCTCAACCACGCCTTCAAGTGAGTGCCCCGC
CCGCCATTTAGAGACCTCAAGGGGATGATTGACCGTCTTGCAGGACCCGAGACCGCGTCATCAAGAACAATTACA
AGCTCGCAAAGGAGGGCGAGGATACGGAACTCGAGTTTCGAGATCAGGGCTTCACCCGCCCCAAGGTGCTGTTCC
TCCTGCCGACCAGGAATTCGTGTGCTCGTGTGATGCACGCCATCCAAGACCTATGCGAAGCGGACCAGCTGGAGA
ACCGTAAGCGGTTCGAGGCCTCTTACGTGGACAGGAGCTCGAGCTTCAGAGAAGACCGGCCGGCCGACTTTATAG
ACCTGTTCGAGGGCAACGACGATGACATGTTCCGCATCGGAGTCAAATTCACGCGCAAGACCATCAAATACTTTG
CCCAGTTCTACAACTCGGACTTGCTGTTAGCCAGTCCGCTGGGCCTGCGAATGGCGATGGGTTCCGAGGAGGACA
GGGGAAAGCCAGACATGGACTTTCTCAGCTCGATCGAGATTGTCGTCATGGACCAGGCCGACGCTCTTCTGATGC
AGAACTGGGACCACGTGGAGCACATCTTCGAGCACCTGAATCGGCAGCCAGGGGACGCTCACGGCTGTGACTTCA
GCCGGCTGAGGAGCTGGTACCTCGACGACCAGGCCAAGTTCTACAGGCAGACGGTGGTGTTGTCGGCCTTTAACA
CGCCCGAGCTGTCGGAGCTGCTGCGGCAACACTGCCACAACTGGGCCGGCAAGGCGCGGCTTCAGCCGGAGTATG
GCGGCGTTATCCAGCAGTTGGGCATCAAGGCGAAGCAGACCTTTTCGCGCTTTCAGCCGGCGTCGGTGGAGCAGG
AACCCGACGCCCGGTTCGAATACTTTGTCTCTGCCATCGTGCCGACGCTGGTCAAGCGGGCCAAGCACTCGAACG
GCTTGCTGCTGTTCGTGCCTTCGTATCTCGACTTCGTCCGGGTGCGCAACTACTTTGCCAACTCGGTCGACGTCA
GCAGCGTCTCGTTTGGAGCCATCTCCGAGTACAGCGAGGTGGCAGACGCCTCGCGCGCGTGCTCGCACTTTGCGT
CGGGCCGGCACCGCCTTCTCCTGTACACGGAGCGAGCGCATCACTTTCGGCGATATCGCATCAGGGGCGTGCACA
AAGTCATCTTCTACGGCCTGCCGGACAACCCCGTCTTTTACCGCGAGGTGGCGGGCGAGTTTTTGAGTCGGAGCG
AGCAGGATCTGAGCATCGAGGTCGGGCAGGGGACGGTGAGGGTCATGTACTCGAAGTTTGACGCGATGAAACTGG
AGAGGGTTGCCGGGTCTGCGAGGGTTGGCAAGATGCTACAGGAGCGCGGTGATACGTTTGACTTTTATTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail