Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|2159
Gene name
Locationscaffold_189:28783..30216
Strand-
Gene length (bp)1433
Transcript length (bp)1278
Coding sequence length (bp)1275
Protein length (aa) 425

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04488 Gly_transf_sug Glycosyltransferase sugar-binding region containing DXD motif 5.7E-11 158 236

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q10323|IMT3_SCHPO Inositol phosphoceramide mannosyltransferase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC17G8.11c PE=1 SV=1 125 286 2.0E-16
sp|O14084|IMT1_SCHPO Inositol phosphoceramide mannosyltransferase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=imt1 PE=3 SV=2 140 319 7.0E-16
sp|P33300|SUR1_YEAST Mannosyl phosphorylinositol ceramide synthase SUR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SUR1 PE=1 SV=1 119 286 2.0E-13
sp|P38287|CSH1_YEAST Mannosyl phosphorylinositol ceramide synthase CSH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CSH1 PE=1 SV=1 138 286 5.0E-13
sp|Q9UT67|IMT2_SCHPO Inositol phosphoceramide mannosyltransferase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC4F11.04c PE=3 SV=1 141 289 6.0E-13

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Golgi apparatus Signal peptide|Transmembrane domain 0.1954 0.1466 0.1013 0.1631 0.1073 0.0095 0.5473 0.1477 0.8533 0.0096

SignalP

(None)

Transmembrane Domains

Domain # Start End Length
1 74 96 22

Transcription Factor Class

(None)

CAZymes

CAZyme category E-value Start End
GT32 6.2E-17 158 237

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
SC16a Pure fungal culture 19.90 8.85 30.95
CcL In ants, during behavior modification 5.15 1.28 9.03
CcD In ants, recently dead 6.28 1.88 10.69

Differential expression

Label1 Label2 Q-value Significant difference
SC16a CcL 0.000286 yes
SC16a CcD 0.000286 yes
CcL CcD 0.637036 no

Orthologs

Orthofinder run ID4
Orthogroup6170
Change Orthofinder run
Species Protein ID
Ophiocordyceps camponoti-floridani Ophcf2|00942
Ophiocordyceps camponoti-rufipedis Ophun1|4529
Ophiocordyceps kimflemingae Ophio5|2159 (this protein)
Ophiocordyceps subramaniannii Hirsu2|5230

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|2159
MEVNSPTPHNSSFCYIRGFDLQLPSLLSPFIWSGSTYSWHASTSISLHQSCPVRHFLSSWRSSFYKVIMFKATLL
RPRVLSLVAVILFFFLFHLLHPLPQNRLSFPAAWTAEKTTTWQVARQTTASDLLGRQPPGVRPSRIPSIFHQSWK
STELPTKFQHWSATCRKTHPAWEWVIWTDDDNLRLVQKHFPSLEMSYRHLPGEIYRADLSRALYMYIFGGVYADL
DMECLRPTEELQKMVAGSFNTPIKAMFGRMGDDPDFQHSIPNAWMLSTPGHPFFLHFLRTIDEQVMDIKANNKSW
PDAESLTGPVALREAIAKYEEDKVRRGRRMKDRITQLVKDGPFGESDDLDHQVFLLPSSFIYPYSWGSDGEPIRG
QCWVLSDGFDADKCKELLEVRQAKSICITYWSHTHTPTGHDFDNMKHIEG
Coding >Ophio5|2159
ATGGAGGTTAACAGTCCAACTCCACATAATTCGAGTTTTTGCTATATCAGAGGGTTCGACTTACAGTTGCCTTCT
CTTCTCTCTCCGTTCATCTGGTCAGGTTCGACGTACAGCTGGCACGCCTCGACTTCCATTTCTCTCCATCAATCT
TGTCCGGTTCGTCATTTCCTCAGCTCTTGGCGAAGCTCCTTCTACAAGGTAATCATGTTCAAGGCTACTCTCCTG
CGTCCCAGAGTGCTATCACTCGTTGCCGTGATCCTTTTCTTCTTCCTTTTCCACCTCCTCCACCCGTTGCCCCAG
AACCGGCTCTCCTTTCCAGCGGCATGGACCGCCGAAAAGACCACGACGTGGCAGGTGGCGAGGCAGACGACAGCC
TCGGACCTCCTGGGGCGCCAGCCCCCAGGGGTACGGCCATCACGTATCCCAAGTATCTTCCATCAGAGCTGGAAG
TCGACTGAGCTGCCGACCAAGTTCCAGCACTGGAGTGCCACCTGCCGCAAAACGCATCCGGCATGGGAGTGGGTG
ATTTGGACCGATGACGACAACCTGCGGCTCGTTCAGAAACACTTTCCGAGCCTCGAGATGAGTTATCGCCATCTG
CCGGGCGAGATCTACCGTGCAGATCTGTCCAGAGCCCTTTACATGTACATCTTCGGAGGTGTCTATGCCGACCTC
GACATGGAATGTCTGCGGCCGACGGAAGAGCTGCAGAAGATGGTTGCCGGCTCCTTCAACACTCCCATCAAAGCC
ATGTTCGGCCGCATGGGAGACGACCCGGACTTCCAGCACTCCATCCCGAACGCGTGGATGTTGTCGACGCCGGGC
CACCCCTTCTTCCTCCACTTTCTCCGGACCATCGATGAGCAAGTCATGGACATCAAGGCAAACAACAAGTCGTGG
CCGGATGCGGAGAGTTTGACGGGGCCGGTTGCATTACGCGAAGCCATCGCCAAATACGAGGAAGACAAGGTGCGC
CGCGGGCGTCGGATGAAGGACCGCATCACGCAACTCGTCAAGGATGGGCCCTTTGGTGAATCCGACGACCTAGAC
CATCAGGTCTTCCTCTTGCCCAGCAGCTTCATCTACCCATACAGCTGGGGATCCGACGGCGAACCGATCCGCGGC
CAGTGTTGGGTCTTGAGCGATGGTTTCGACGCCGACAAGTGCAAGGAGCTGCTCGAGGTCCGTCAGGCAAAGAGC
ATATGCATAACGTATTGGAGTCACACGCATACCCCAACGGGGCATGACTTCGACAATATGAAGCATATCGAAGGG
Transcript >Ophio5|2159
ATGGAGGTTAACAGTCCAACTCCACATAATTCGAGTTTTTGCTATATCAGAGGGTTCGACTTACAGTTGCCTTCT
CTTCTCTCTCCGTTCATCTGGTCAGGTTCGACGTACAGCTGGCACGCCTCGACTTCCATTTCTCTCCATCAATCT
TGTCCGGTTCGTCATTTCCTCAGCTCTTGGCGAAGCTCCTTCTACAAGGTAATCATGTTCAAGGCTACTCTCCTG
CGTCCCAGAGTGCTATCACTCGTTGCCGTGATCCTTTTCTTCTTCCTTTTCCACCTCCTCCACCCGTTGCCCCAG
AACCGGCTCTCCTTTCCAGCGGCATGGACCGCCGAAAAGACCACGACGTGGCAGGTGGCGAGGCAGACGACAGCC
TCGGACCTCCTGGGGCGCCAGCCCCCAGGGGTACGGCCATCACGTATCCCAAGTATCTTCCATCAGAGCTGGAAG
TCGACTGAGCTGCCGACCAAGTTCCAGCACTGGAGTGCCACCTGCCGCAAAACGCATCCGGCATGGGAGTGGGTG
ATTTGGACCGATGACGACAACCTGCGGCTCGTTCAGAAACACTTTCCGAGCCTCGAGATGAGTTATCGCCATCTG
CCGGGCGAGATCTACCGTGCAGATCTGTCCAGAGCCCTTTACATGTACATCTTCGGAGGTGTCTATGCCGACCTC
GACATGGAATGTCTGCGGCCGACGGAAGAGCTGCAGAAGATGGTTGCCGGCTCCTTCAACACTCCCATCAAAGCC
ATGTTCGGCCGCATGGGAGACGACCCGGACTTCCAGCACTCCATCCCGAACGCGTGGATGTTGTCGACGCCGGGC
CACCCCTTCTTCCTCCACTTTCTCCGGACCATCGATGAGCAAGTCATGGACATCAAGGCAAACAACAAGTCGTGG
CCGGATGCGGAGAGTTTGACGGGGCCGGTTGCATTACGCGAAGCCATCGCCAAATACGAGGAAGACAAGGTGCGC
CGCGGGCGTCGGATGAAGGACCGCATCACGCAACTCGTCAAGGATGGGCCCTTTGGTGAATCCGACGACCTAGAC
CATCAGGTCTTCCTCTTGCCCAGCAGCTTCATCTACCCATACAGCTGGGGATCCGACGGCGAACCGATCCGCGGC
CAGTGTTGGGTCTTGAGCGATGGTTTCGACGCCGACAAGTGCAAGGAGCTGCTCGAGGTCCGTCAGGCAAAGAGC
ATATGCATAACGTATTGGAGTCACACGCATACCCCAACGGGGCATGACTTCGACAATATGAAGCATATCGAAGGG
TAG
Gene >Ophio5|2159
ATGGAGGTTAACAGTCCAACTCCACATAATTCGAGTTTTTGCTATATCAGAGGGTACATATAGCCGGCATTGTTT
GGCATTCATCCCTCTACGCTAATTCGGTCAGGTTCGACTTACAGTTGCCTTCTCTTCTCTCTCCGTTCATCTGGT
CAGGTTCGACTCACAGTTGCCTTCTCTTCTCTCTCCGTTCATCTGGTCAGGTTCGACGTACAGCTGGCACGCCTC
GACTTCCATTTCTCTCCATCAATCTTGTCCGGTTCGTCATTTCCTCAGCTCTTGGCGAAGCTCCTTCTACAAGGT
AATCATGTTCAAGGCTACTCTCCTGCGTCCCAGAGTGCTATCACTCGTTGCCGTGATCCTTTTCTTCTTCCTTTT
CCACCTCCTCCACCCGTTGCCCCAGAACCGGCTCTCCTTTCCAGCGGCATGGACCGCCGAAAAGACCACGACGTG
GCAGGTGGCGAGGCAGACGACAGCCTCGGACCTCCTGGGGCGCCAGCCCCCAGGGGTACGGCCATCACGTATCCC
AAGTATCTTCCATCAGAGCTGGAAGTCGACTGAGCTGCCGACCAAGTTCCAGCACTGGAGTGCCACCTGCCGCAA
AACGCATCCGGCATGGGAGTGGGTGATTTGGACCGATGACGACAACCTGCGGCTCGTTCAGAAACACTTTCCGAG
CCTCGAGATGAGTTATCGCCATCTGCCGGGCGAGATCTACCGTGCAGATCTGTCCAGAGCCCTTTACATGTACAT
CTTCGGAGGGTGCGTTCTCCCATTACCAGAATTGACACATGGGAACTGATTGGAGAGAATACAGTGTCTATGCCG
ACCTCGACATGGAATGTCTGCGGCCGACGGAAGAGCTGCAGAAGATGGTTGCCGGCTCCTTCAACACTCCCATCA
AAGCCATGTTCGGCCGCATGGGAGACGACCCGGACTTCCAGCACTCCATCCCGAACGCGTGGATGTTGTCGACGC
CGGGCCACCCCTTCTTCCTCCACTTTCTCCGGACCATCGATGAGCAAGTCATGGACATCAAGGCAAACAACAAGT
CGTGGCCGGATGCGGAGAGTTTGACGGGGCCGGTTGCATTACGCGAAGCCATCGCCAAATACGAGGAAGACAAGG
TGCGCCGCGGGCGTCGGATGAAGGACCGCATCACGCAACTCGTCAAGGATGGGCCCTTTGGTGAATCCGACGACC
TAGACCATCAGGTCTTCCTCTTGCCCAGCAGCTTCATCTACCCATACAGCTGGGGATCCGACGGCGAACCGATCC
GCGGCCAGTGTTGGGTCTTGAGCGATGGTTTCGACGCCGACAAGTGCAAGGAGCTGCTCGAGGTCCGTCAGGCAA
AGAGCATATGCATAACGTATTGGAGTCACACGCATACCCCAACGGGGCATGACTTCGACAATATGAAGCATATCG
AAGGGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail