Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|2159
Gene name
Locationscaffold_189:28783..30216
Strand-
Gene length (bp)1433
Transcript length (bp)1278
Coding sequence length (bp)1275
Protein length (aa) 425

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04488 Gly_transf_sug Glycosyltransferase sugar-binding region containing DXD motif 5.7E-11 158 236

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q10323|IMT3_SCHPO Inositol phosphoceramide mannosyltransferase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC17G8.11c PE=1 SV=1 125 286 2.0E-16
sp|O14084|IMT1_SCHPO Inositol phosphoceramide mannosyltransferase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=imt1 PE=3 SV=2 140 319 7.0E-16
sp|P33300|SUR1_YEAST Mannosyl phosphorylinositol ceramide synthase SUR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SUR1 PE=1 SV=1 119 286 2.0E-13
sp|P38287|CSH1_YEAST Mannosyl phosphorylinositol ceramide synthase CSH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CSH1 PE=1 SV=1 138 286 5.0E-13
sp|Q9UT67|IMT2_SCHPO Inositol phosphoceramide mannosyltransferase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC4F11.04c PE=3 SV=1 141 289 6.0E-13

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Golgi apparatus Signal peptide|Transmembrane domain 0.1954 0.1466 0.1013 0.1631 0.1073 0.0095 0.5473 0.1477 0.8533 0.0096

SignalP

(None)

Transmembrane Domains

Domain # Start End Length
1 74 96 22

Transcription Factor Class

(None)

CAZymes

CAZyme category E-value Start End
GT32 6.2E-17 158 237

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup6170
Change Orthofinder run
Species Protein ID
Ophiocordyceps camponoti-floridani Ophcf2|00942
Ophiocordyceps camponoti-rufipedis Ophun1|4529
Ophiocordyceps kimflemingae Ophio5|2159 (this protein)
Ophiocordyceps subramaniannii Hirsu2|5230

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|2159
MEVNSPTPHNSSFCYIRGFDLQLPSLLSPFIWSGSTYSWHASTSISLHQSCPVRHFLSSWRSSFYKVIMFKATLL
RPRVLSLVAVILFFFLFHLLHPLPQNRLSFPAAWTAEKTTTWQVARQTTASDLLGRQPPGVRPSRIPSIFHQSWK
STELPTKFQHWSATCRKTHPAWEWVIWTDDDNLRLVQKHFPSLEMSYRHLPGEIYRADLSRALYMYIFGGVYADL
DMECLRPTEELQKMVAGSFNTPIKAMFGRMGDDPDFQHSIPNAWMLSTPGHPFFLHFLRTIDEQVMDIKANNKSW
PDAESLTGPVALREAIAKYEEDKVRRGRRMKDRITQLVKDGPFGESDDLDHQVFLLPSSFIYPYSWGSDGEPIRG
QCWVLSDGFDADKCKELLEVRQAKSICITYWSHTHTPTGHDFDNMKHIEG
Coding >Ophio5|2159
ATGGAGGTTAACAGTCCAACTCCACATAATTCGAGTTTTTGCTATATCAGAGGGTTCGACTTACAGTTGCCTTCT
CTTCTCTCTCCGTTCATCTGGTCAGGTTCGACGTACAGCTGGCACGCCTCGACTTCCATTTCTCTCCATCAATCT
TGTCCGGTTCGTCATTTCCTCAGCTCTTGGCGAAGCTCCTTCTACAAGGTAATCATGTTCAAGGCTACTCTCCTG
CGTCCCAGAGTGCTATCACTCGTTGCCGTGATCCTTTTCTTCTTCCTTTTCCACCTCCTCCACCCGTTGCCCCAG
AACCGGCTCTCCTTTCCAGCGGCATGGACCGCCGAAAAGACCACGACGTGGCAGGTGGCGAGGCAGACGACAGCC
TCGGACCTCCTGGGGCGCCAGCCCCCAGGGGTACGGCCATCACGTATCCCAAGTATCTTCCATCAGAGCTGGAAG
TCGACTGAGCTGCCGACCAAGTTCCAGCACTGGAGTGCCACCTGCCGCAAAACGCATCCGGCATGGGAGTGGGTG
ATTTGGACCGATGACGACAACCTGCGGCTCGTTCAGAAACACTTTCCGAGCCTCGAGATGAGTTATCGCCATCTG
CCGGGCGAGATCTACCGTGCAGATCTGTCCAGAGCCCTTTACATGTACATCTTCGGAGGTGTCTATGCCGACCTC
GACATGGAATGTCTGCGGCCGACGGAAGAGCTGCAGAAGATGGTTGCCGGCTCCTTCAACACTCCCATCAAAGCC
ATGTTCGGCCGCATGGGAGACGACCCGGACTTCCAGCACTCCATCCCGAACGCGTGGATGTTGTCGACGCCGGGC
CACCCCTTCTTCCTCCACTTTCTCCGGACCATCGATGAGCAAGTCATGGACATCAAGGCAAACAACAAGTCGTGG
CCGGATGCGGAGAGTTTGACGGGGCCGGTTGCATTACGCGAAGCCATCGCCAAATACGAGGAAGACAAGGTGCGC
CGCGGGCGTCGGATGAAGGACCGCATCACGCAACTCGTCAAGGATGGGCCCTTTGGTGAATCCGACGACCTAGAC
CATCAGGTCTTCCTCTTGCCCAGCAGCTTCATCTACCCATACAGCTGGGGATCCGACGGCGAACCGATCCGCGGC
CAGTGTTGGGTCTTGAGCGATGGTTTCGACGCCGACAAGTGCAAGGAGCTGCTCGAGGTCCGTCAGGCAAAGAGC
ATATGCATAACGTATTGGAGTCACACGCATACCCCAACGGGGCATGACTTCGACAATATGAAGCATATCGAAGGG
Transcript >Ophio5|2159
ATGGAGGTTAACAGTCCAACTCCACATAATTCGAGTTTTTGCTATATCAGAGGGTTCGACTTACAGTTGCCTTCT
CTTCTCTCTCCGTTCATCTGGTCAGGTTCGACGTACAGCTGGCACGCCTCGACTTCCATTTCTCTCCATCAATCT
TGTCCGGTTCGTCATTTCCTCAGCTCTTGGCGAAGCTCCTTCTACAAGGTAATCATGTTCAAGGCTACTCTCCTG
CGTCCCAGAGTGCTATCACTCGTTGCCGTGATCCTTTTCTTCTTCCTTTTCCACCTCCTCCACCCGTTGCCCCAG
AACCGGCTCTCCTTTCCAGCGGCATGGACCGCCGAAAAGACCACGACGTGGCAGGTGGCGAGGCAGACGACAGCC
TCGGACCTCCTGGGGCGCCAGCCCCCAGGGGTACGGCCATCACGTATCCCAAGTATCTTCCATCAGAGCTGGAAG
TCGACTGAGCTGCCGACCAAGTTCCAGCACTGGAGTGCCACCTGCCGCAAAACGCATCCGGCATGGGAGTGGGTG
ATTTGGACCGATGACGACAACCTGCGGCTCGTTCAGAAACACTTTCCGAGCCTCGAGATGAGTTATCGCCATCTG
CCGGGCGAGATCTACCGTGCAGATCTGTCCAGAGCCCTTTACATGTACATCTTCGGAGGTGTCTATGCCGACCTC
GACATGGAATGTCTGCGGCCGACGGAAGAGCTGCAGAAGATGGTTGCCGGCTCCTTCAACACTCCCATCAAAGCC
ATGTTCGGCCGCATGGGAGACGACCCGGACTTCCAGCACTCCATCCCGAACGCGTGGATGTTGTCGACGCCGGGC
CACCCCTTCTTCCTCCACTTTCTCCGGACCATCGATGAGCAAGTCATGGACATCAAGGCAAACAACAAGTCGTGG
CCGGATGCGGAGAGTTTGACGGGGCCGGTTGCATTACGCGAAGCCATCGCCAAATACGAGGAAGACAAGGTGCGC
CGCGGGCGTCGGATGAAGGACCGCATCACGCAACTCGTCAAGGATGGGCCCTTTGGTGAATCCGACGACCTAGAC
CATCAGGTCTTCCTCTTGCCCAGCAGCTTCATCTACCCATACAGCTGGGGATCCGACGGCGAACCGATCCGCGGC
CAGTGTTGGGTCTTGAGCGATGGTTTCGACGCCGACAAGTGCAAGGAGCTGCTCGAGGTCCGTCAGGCAAAGAGC
ATATGCATAACGTATTGGAGTCACACGCATACCCCAACGGGGCATGACTTCGACAATATGAAGCATATCGAAGGG
TAG
Gene >Ophio5|2159
ATGGAGGTTAACAGTCCAACTCCACATAATTCGAGTTTTTGCTATATCAGAGGGTACATATAGCCGGCATTGTTT
GGCATTCATCCCTCTACGCTAATTCGGTCAGGTTCGACTTACAGTTGCCTTCTCTTCTCTCTCCGTTCATCTGGT
CAGGTTCGACTCACAGTTGCCTTCTCTTCTCTCTCCGTTCATCTGGTCAGGTTCGACGTACAGCTGGCACGCCTC
GACTTCCATTTCTCTCCATCAATCTTGTCCGGTTCGTCATTTCCTCAGCTCTTGGCGAAGCTCCTTCTACAAGGT
AATCATGTTCAAGGCTACTCTCCTGCGTCCCAGAGTGCTATCACTCGTTGCCGTGATCCTTTTCTTCTTCCTTTT
CCACCTCCTCCACCCGTTGCCCCAGAACCGGCTCTCCTTTCCAGCGGCATGGACCGCCGAAAAGACCACGACGTG
GCAGGTGGCGAGGCAGACGACAGCCTCGGACCTCCTGGGGCGCCAGCCCCCAGGGGTACGGCCATCACGTATCCC
AAGTATCTTCCATCAGAGCTGGAAGTCGACTGAGCTGCCGACCAAGTTCCAGCACTGGAGTGCCACCTGCCGCAA
AACGCATCCGGCATGGGAGTGGGTGATTTGGACCGATGACGACAACCTGCGGCTCGTTCAGAAACACTTTCCGAG
CCTCGAGATGAGTTATCGCCATCTGCCGGGCGAGATCTACCGTGCAGATCTGTCCAGAGCCCTTTACATGTACAT
CTTCGGAGGGTGCGTTCTCCCATTACCAGAATTGACACATGGGAACTGATTGGAGAGAATACAGTGTCTATGCCG
ACCTCGACATGGAATGTCTGCGGCCGACGGAAGAGCTGCAGAAGATGGTTGCCGGCTCCTTCAACACTCCCATCA
AAGCCATGTTCGGCCGCATGGGAGACGACCCGGACTTCCAGCACTCCATCCCGAACGCGTGGATGTTGTCGACGC
CGGGCCACCCCTTCTTCCTCCACTTTCTCCGGACCATCGATGAGCAAGTCATGGACATCAAGGCAAACAACAAGT
CGTGGCCGGATGCGGAGAGTTTGACGGGGCCGGTTGCATTACGCGAAGCCATCGCCAAATACGAGGAAGACAAGG
TGCGCCGCGGGCGTCGGATGAAGGACCGCATCACGCAACTCGTCAAGGATGGGCCCTTTGGTGAATCCGACGACC
TAGACCATCAGGTCTTCCTCTTGCCCAGCAGCTTCATCTACCCATACAGCTGGGGATCCGACGGCGAACCGATCC
GCGGCCAGTGTTGGGTCTTGAGCGATGGTTTCGACGCCGACAAGTGCAAGGAGCTGCTCGAGGTCCGTCAGGCAA
AGAGCATATGCATAACGTATTGGAGTCACACGCATACCCCAACGGGGCATGACTTCGACAATATGAAGCATATCG
AAGGGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail