Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|2156
Gene name
Locationscaffold_189:22936..23625
Strand+
Gene length (bp)689
Transcript length (bp)636
Coding sequence length (bp)633
Protein length (aa) 211

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q6DHQ1|HVCN1_DANRE Voltage-gated hydrogen channel 1 OS=Danio rerio GN=hvcn1 PE=2 SV=1 4 201 8.0E-13
sp|Q5F4C0|HVCN1_CHICK Voltage-gated hydrogen channel 1 OS=Gallus gallus GN=HVCN1 PE=2 SV=1 40 178 7.0E-08
sp|Q5M7E9|HVCN1_XENLA Voltage-gated hydrogen channel 1 OS=Xenopus laevis GN=hvcn1 PE=2 SV=1 91 188 5.0E-07
sp|Q5M8L8|HVCN1_XENTR Voltage-gated hydrogen channel 1 OS=Xenopus tropicalis GN=hvcn1 PE=2 SV=1 91 191 1.0E-06

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 66 0.5

Transmembrane Domains

Domain # Start End Length
1 55 77 22
2 87 109 22
3 116 138 22
4 143 162 19

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
SC16a Pure fungal culture 17.66 5.72 29.59
CcL In ants, during behavior modification 1.42 0.00 3.28
CcD In ants, recently dead 0.19 0.00 0.68

Differential expression

Label1 Label2 Q-value Significant difference
SC16a CcL 0.002236 yes
SC16a CcD 0.269661 no
CcL CcD 1.000000 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|2156
MTDSDAASAPLLPSHARSYDASSSPPPPSGSGLRARLAHMRAAAARSLSSRRKHFAIMAIVSLDVFALLVEVFIR
LIACETGQAREPWVLIMISVLGTIGLVISCLFMVELAACLLVYGFGYLCSWFHLFDAVVIVISFIVDVGLRGVAG
SIGSLVVVLRLWRLAKLSEEVVLGASERMDLLEHHLEEVQSENKQLRAQLGLDSVDHSSHA
Coding >Ophio5|2156
ATGACCGACTCCGACGCCGCGTCGGCTCCCCTGCTACCGTCCCATGCCCGCTCTTACGATGCGTCGTCATCTCCG
CCGCCGCCTTCGGGGTCCGGCCTGCGCGCCCGCCTTGCCCATATGCGCGCCGCGGCCGCGAGAAGCCTCTCGTCG
CGCCGCAAGCACTTTGCCATCATGGCCATTGTCAGCCTCGATGTCTTCGCCCTGCTCGTCGAAGTCTTCATCCGG
CTTATCGCGTGCGAGACGGGTCAGGCCCGAGAGCCCTGGGTGCTGATCATGATTTCTGTTCTCGGCACCATCGGC
CTTGTCATTAGCTGCCTCTTCATGGTTGAGCTCGCCGCCTGCTTACTCGTCTATGGCTTTGGTTATCTCTGCTCC
TGGTTCCACCTTTTTGACGCAGTCGTCATCGTCATCAGCTTCATCGTCGACGTGGGTCTGCGTGGAGTCGCTGGT
TCCATAGGCTCCCTCGTCGTCGTCCTTCGACTATGGCGTCTTGCCAAGCTGTCGGAGGAAGTTGTCTTGGGGGCA
TCGGAGAGAATGGACTTGTTGGAACACCATCTGGAGGAGGTCCAAAGCGAGAACAAGCAGTTGAGGGCTCAACTA
GGACTGGACTCCGTAGACCATTCTAGCCACGCA
Transcript >Ophio5|2156
ATGACCGACTCCGACGCCGCGTCGGCTCCCCTGCTACCGTCCCATGCCCGCTCTTACGATGCGTCGTCATCTCCG
CCGCCGCCTTCGGGGTCCGGCCTGCGCGCCCGCCTTGCCCATATGCGCGCCGCGGCCGCGAGAAGCCTCTCGTCG
CGCCGCAAGCACTTTGCCATCATGGCCATTGTCAGCCTCGATGTCTTCGCCCTGCTCGTCGAAGTCTTCATCCGG
CTTATCGCGTGCGAGACGGGTCAGGCCCGAGAGCCCTGGGTGCTGATCATGATTTCTGTTCTCGGCACCATCGGC
CTTGTCATTAGCTGCCTCTTCATGGTTGAGCTCGCCGCCTGCTTACTCGTCTATGGCTTTGGTTATCTCTGCTCC
TGGTTCCACCTTTTTGACGCAGTCGTCATCGTCATCAGCTTCATCGTCGACGTGGGTCTGCGTGGAGTCGCTGGT
TCCATAGGCTCCCTCGTCGTCGTCCTTCGACTATGGCGTCTTGCCAAGCTGTCGGAGGAAGTTGTCTTGGGGGCA
TCGGAGAGAATGGACTTGTTGGAACACCATCTGGAGGAGGTCCAAAGCGAGAACAAGCAGTTGAGGGCTCAACTA
GGACTGGACTCCGTAGACCATTCTAGCCACGCATGA
Gene >Ophio5|2156
ATGACCGACTCCGACGCCGCGTCGGCTCCCCTGCTACCGTCCCATGCCCGCTCTTACGATGCGTCGTCATCTCCG
CCGCCGCCTTCGGGGTCCGGCCTGCGCGCCCGCCTTGCCCATATGCGCGCCGCGGCCGCGAGAAGCCTCTCGTCG
CGCCGCAAGCACTTTGCCATCATGGCCATTGTCAGCCTCGATGTCTTCGCCCTGCTCGTCGAAGTCTTCATCCGG
CTTATCGCGTGCGAGACGGGTCAGGCCCGAGAGCCCTGGGTGCTGATCATGATTTCTGTTCTCGGCACCATCGGC
CTTGTCATTAGCTGCCTCTTCATGGTTGAGCTCGCCGCCTGCTTACTCGTCTATGGCTTTGGGTAATGGCTTCAT
CTCATGCACATCTTCTCGTCCTGCTGACTCGTGGCCCAAGTTATCTCTGCTCCTGGTTCCACCTTTTTGACGCAG
TCGTCATCGTCATCAGCTTCATCGTCGACGTGGGTCTGCGTGGAGTCGCTGGTTCCATAGGCTCCCTCGTCGTCG
TCCTTCGACTATGGCGTCTTGCCAAGCTGTCGGAGGAAGTTGTCTTGGGGGCATCGGAGAGAATGGACTTGTTGG
AACACCATCTGGAGGAGGTCCAAAGCGAGAACAAGCAGTTGAGGGCTCAACTAGGACTGGACTCCGTAGACCATT
CTAGCCACGCATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail