Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|2156
Gene name
Locationscaffold_189:22936..23625
Strand+
Gene length (bp)689
Transcript length (bp)636
Coding sequence length (bp)633
Protein length (aa) 211

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q6DHQ1|HVCN1_DANRE Voltage-gated hydrogen channel 1 OS=Danio rerio GN=hvcn1 PE=2 SV=1 4 201 8.0E-13
sp|Q5F4C0|HVCN1_CHICK Voltage-gated hydrogen channel 1 OS=Gallus gallus GN=HVCN1 PE=2 SV=1 40 178 7.0E-08
sp|Q5M7E9|HVCN1_XENLA Voltage-gated hydrogen channel 1 OS=Xenopus laevis GN=hvcn1 PE=2 SV=1 91 188 5.0E-07
sp|Q5M8L8|HVCN1_XENTR Voltage-gated hydrogen channel 1 OS=Xenopus tropicalis GN=hvcn1 PE=2 SV=1 91 191 1.0E-06

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 66 0.5

Transmembrane Domains

Domain # Start End Length
1 55 77 22
2 87 109 22
3 116 138 22
4 143 162 19

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|2156
MTDSDAASAPLLPSHARSYDASSSPPPPSGSGLRARLAHMRAAAARSLSSRRKHFAIMAIVSLDVFALLVEVFIR
LIACETGQAREPWVLIMISVLGTIGLVISCLFMVELAACLLVYGFGYLCSWFHLFDAVVIVISFIVDVGLRGVAG
SIGSLVVVLRLWRLAKLSEEVVLGASERMDLLEHHLEEVQSENKQLRAQLGLDSVDHSSHA
Coding >Ophio5|2156
ATGACCGACTCCGACGCCGCGTCGGCTCCCCTGCTACCGTCCCATGCCCGCTCTTACGATGCGTCGTCATCTCCG
CCGCCGCCTTCGGGGTCCGGCCTGCGCGCCCGCCTTGCCCATATGCGCGCCGCGGCCGCGAGAAGCCTCTCGTCG
CGCCGCAAGCACTTTGCCATCATGGCCATTGTCAGCCTCGATGTCTTCGCCCTGCTCGTCGAAGTCTTCATCCGG
CTTATCGCGTGCGAGACGGGTCAGGCCCGAGAGCCCTGGGTGCTGATCATGATTTCTGTTCTCGGCACCATCGGC
CTTGTCATTAGCTGCCTCTTCATGGTTGAGCTCGCCGCCTGCTTACTCGTCTATGGCTTTGGTTATCTCTGCTCC
TGGTTCCACCTTTTTGACGCAGTCGTCATCGTCATCAGCTTCATCGTCGACGTGGGTCTGCGTGGAGTCGCTGGT
TCCATAGGCTCCCTCGTCGTCGTCCTTCGACTATGGCGTCTTGCCAAGCTGTCGGAGGAAGTTGTCTTGGGGGCA
TCGGAGAGAATGGACTTGTTGGAACACCATCTGGAGGAGGTCCAAAGCGAGAACAAGCAGTTGAGGGCTCAACTA
GGACTGGACTCCGTAGACCATTCTAGCCACGCA
Transcript >Ophio5|2156
ATGACCGACTCCGACGCCGCGTCGGCTCCCCTGCTACCGTCCCATGCCCGCTCTTACGATGCGTCGTCATCTCCG
CCGCCGCCTTCGGGGTCCGGCCTGCGCGCCCGCCTTGCCCATATGCGCGCCGCGGCCGCGAGAAGCCTCTCGTCG
CGCCGCAAGCACTTTGCCATCATGGCCATTGTCAGCCTCGATGTCTTCGCCCTGCTCGTCGAAGTCTTCATCCGG
CTTATCGCGTGCGAGACGGGTCAGGCCCGAGAGCCCTGGGTGCTGATCATGATTTCTGTTCTCGGCACCATCGGC
CTTGTCATTAGCTGCCTCTTCATGGTTGAGCTCGCCGCCTGCTTACTCGTCTATGGCTTTGGTTATCTCTGCTCC
TGGTTCCACCTTTTTGACGCAGTCGTCATCGTCATCAGCTTCATCGTCGACGTGGGTCTGCGTGGAGTCGCTGGT
TCCATAGGCTCCCTCGTCGTCGTCCTTCGACTATGGCGTCTTGCCAAGCTGTCGGAGGAAGTTGTCTTGGGGGCA
TCGGAGAGAATGGACTTGTTGGAACACCATCTGGAGGAGGTCCAAAGCGAGAACAAGCAGTTGAGGGCTCAACTA
GGACTGGACTCCGTAGACCATTCTAGCCACGCATGA
Gene >Ophio5|2156
ATGACCGACTCCGACGCCGCGTCGGCTCCCCTGCTACCGTCCCATGCCCGCTCTTACGATGCGTCGTCATCTCCG
CCGCCGCCTTCGGGGTCCGGCCTGCGCGCCCGCCTTGCCCATATGCGCGCCGCGGCCGCGAGAAGCCTCTCGTCG
CGCCGCAAGCACTTTGCCATCATGGCCATTGTCAGCCTCGATGTCTTCGCCCTGCTCGTCGAAGTCTTCATCCGG
CTTATCGCGTGCGAGACGGGTCAGGCCCGAGAGCCCTGGGTGCTGATCATGATTTCTGTTCTCGGCACCATCGGC
CTTGTCATTAGCTGCCTCTTCATGGTTGAGCTCGCCGCCTGCTTACTCGTCTATGGCTTTGGGTAATGGCTTCAT
CTCATGCACATCTTCTCGTCCTGCTGACTCGTGGCCCAAGTTATCTCTGCTCCTGGTTCCACCTTTTTGACGCAG
TCGTCATCGTCATCAGCTTCATCGTCGACGTGGGTCTGCGTGGAGTCGCTGGTTCCATAGGCTCCCTCGTCGTCG
TCCTTCGACTATGGCGTCTTGCCAAGCTGTCGGAGGAAGTTGTCTTGGGGGCATCGGAGAGAATGGACTTGTTGG
AACACCATCTGGAGGAGGTCCAAAGCGAGAACAAGCAGTTGAGGGCTCAACTAGGACTGGACTCCGTAGACCATT
CTAGCCACGCATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail