Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|2154
Gene name
Locationscaffold_189:15867..19227
Strand-
Gene length (bp)3360
Transcript length (bp)2850
Coding sequence length (bp)2847
Protein length (aa) 949

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00632 HECT HECT-domain (ubiquitin-transferase) 5.5E-91 645 947
PF00397 WW WW domain 2.2E-10 354 383
PF00397 WW WW domain 1.3E-12 469 498
PF00397 WW WW domain 2.9E-10 528 557
PF00168 C2 C2 domain 1.1E-20 135 224

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q5BDP1|RSP5_EMENI E3 ubiquitin-protein ligase RSP5 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=hulA PE=1 SV=1 128 949 0.0E+00
sp|Q0CCL1|RSP5_ASPTN Probable E3 ubiquitin-protein ligase hulA OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=hulA PE=3 SV=1 128 949 0.0E+00
sp|A1D3C5|RSP5_NEOFI Probable E3 ubiquitin-protein ligase hulA OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=hulA PE=3 SV=1 128 949 0.0E+00
sp|Q2UBP1|RSP5_ASPOR Probable E3 ubiquitin-protein ligase hulA OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=hulA PE=3 SV=2 128 949 0.0E+00
sp|B8N7E5|RSP5_ASPFN Probable E3 ubiquitin-protein ligase hulA OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=hulA PE=3 SV=1 132 949 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q5BDP1|RSP5_EMENI E3 ubiquitin-protein ligase RSP5 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=hulA PE=1 SV=1 128 949 0.0E+00
sp|Q0CCL1|RSP5_ASPTN Probable E3 ubiquitin-protein ligase hulA OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=hulA PE=3 SV=1 128 949 0.0E+00
sp|A1D3C5|RSP5_NEOFI Probable E3 ubiquitin-protein ligase hulA OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=hulA PE=3 SV=1 128 949 0.0E+00
sp|Q2UBP1|RSP5_ASPOR Probable E3 ubiquitin-protein ligase hulA OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=hulA PE=3 SV=2 128 949 0.0E+00
sp|B8N7E5|RSP5_ASPFN Probable E3 ubiquitin-protein ligase hulA OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=hulA PE=3 SV=1 132 949 0.0E+00
sp|A2QQ28|RSP5_ASPNC Probable E3 ubiquitin-protein ligase hulA OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=hulA PE=3 SV=1 128 949 0.0E+00
sp|A1CQG2|RSP5_ASPCL Probable E3 ubiquitin-protein ligase hulA OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=hulA PE=3 SV=2 128 949 0.0E+00
sp|Q4WTF3|RSP5_ASPFU Probable E3 ubiquitin-protein ligase hulA OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=hulA PE=3 SV=2 128 949 0.0E+00
sp|B0XQ72|RSP5_ASPFC Probable E3 ubiquitin-protein ligase hulA OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=hulA PE=3 SV=2 128 949 0.0E+00
sp|Q92462|PUB1_SCHPO E3 ubiquitin-protein ligase pub1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pub1 PE=1 SV=2 136 949 0.0E+00
sp|P39940|RSP5_YEAST E3 ubiquitin-protein ligase RSP5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RSP5 PE=1 SV=1 134 949 0.0E+00
sp|O14326|PUB3_SCHPO E3 ubiquitin-protein ligase pub3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pub3 PE=2 SV=1 136 949 0.0E+00
sp|Q8C863|ITCH_MOUSE E3 ubiquitin-protein ligase Itchy OS=Mus musculus GN=Itch PE=1 SV=2 126 949 0.0E+00
sp|Q8CFI0|NED4L_MOUSE E3 ubiquitin-protein ligase NEDD4-like OS=Mus musculus GN=Nedd4l PE=1 SV=2 317 946 1.0E-180
sp|Q96PU5|NED4L_HUMAN E3 ubiquitin-protein ligase NEDD4-like OS=Homo sapiens GN=NEDD4L PE=1 SV=2 291 946 5.0E-180
sp|Q5RBF2|NED4L_PONAB E3 ubiquitin-protein ligase NEDD4-like OS=Pongo abelii GN=NEDD4L PE=2 SV=1 354 946 2.0E-178
sp|Q96J02|ITCH_HUMAN E3 ubiquitin-protein ligase Itchy homolog OS=Homo sapiens GN=ITCH PE=1 SV=2 354 949 3.0E-178
sp|Q9DBH0|WWP2_MOUSE NEDD4-like E3 ubiquitin-protein ligase WWP2 OS=Mus musculus GN=Wwp2 PE=1 SV=1 123 949 2.0E-176
sp|Q8BZZ3|WWP1_MOUSE NEDD4-like E3 ubiquitin-protein ligase WWP1 OS=Mus musculus GN=Wwp1 PE=1 SV=2 350 949 2.0E-175
sp|O00308|WWP2_HUMAN NEDD4-like E3 ubiquitin-protein ligase WWP2 OS=Homo sapiens GN=WWP2 PE=1 SV=2 264 949 4.0E-175
sp|Q9H0M0|WWP1_HUMAN NEDD4-like E3 ubiquitin-protein ligase WWP1 OS=Homo sapiens GN=WWP1 PE=1 SV=1 323 949 4.0E-175
sp|P46934|NEDD4_HUMAN E3 ubiquitin-protein ligase NEDD4 OS=Homo sapiens GN=NEDD4 PE=1 SV=4 319 946 2.0E-173
sp|Q9HCE7|SMUF1_HUMAN E3 ubiquitin-protein ligase SMURF1 OS=Homo sapiens GN=SMURF1 PE=1 SV=2 132 949 6.0E-172
sp|A2A5Z6|SMUF2_MOUSE E3 ubiquitin-protein ligase SMURF2 OS=Mus musculus GN=Smurf2 PE=1 SV=1 134 949 2.0E-171
sp|A9JRZ0|SMUF2_DANRE E3 ubiquitin-protein ligase SMURF2 OS=Danio rerio GN=smurf2 PE=2 SV=1 134 949 3.0E-171
sp|Q9HAU4|SMUF2_HUMAN E3 ubiquitin-protein ligase SMURF2 OS=Homo sapiens GN=SMURF2 PE=1 SV=1 134 949 2.0E-170
sp|Q2TAS2|SMUF2_XENLA E3 ubiquitin-protein ligase SMURF2 OS=Xenopus laevis GN=smurf2 PE=2 SV=1 134 949 9.0E-170
sp|P46935|NEDD4_MOUSE E3 ubiquitin-protein ligase NEDD4 OS=Mus musculus GN=Nedd4 PE=1 SV=3 357 946 6.0E-169
sp|Q62940|NEDD4_RAT E3 ubiquitin-protein ligase NEDD4 OS=Rattus norvegicus GN=Nedd4 PE=1 SV=1 357 946 5.0E-167
sp|Q9Y0H4|SUDX_DROME E3 ubiquitin-protein ligase Su(dx) OS=Drosophila melanogaster GN=Su(dx) PE=1 SV=1 335 949 4.0E-166
sp|Q9UTG2|PUB2_SCHPO E3 ubiquitin-protein ligase pub2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pub2 PE=1 SV=1 517 949 7.0E-158
sp|Q9VVI3|NEDD4_DROME E3 ubiquitin-protein ligase Nedd-4 OS=Drosophila melanogaster GN=Nedd4 PE=1 SV=2 469 947 2.0E-156
sp|Q9CUN6|SMUF1_MOUSE E3 ubiquitin-protein ligase SMURF1 OS=Mus musculus GN=Smurf1 PE=2 SV=2 466 949 2.0E-156
sp|Q9PUN2|SMUF1_XENLA E3 ubiquitin-protein ligase SMURF1 OS=Xenopus laevis GN=smurf1 PE=2 SV=1 466 949 6.0E-154
sp|Q9V853|SMUF1_DROME E3 ubiquitin-protein ligase Smurf1 OS=Drosophila melanogaster GN=lack PE=1 SV=3 557 949 6.0E-131
sp|Q6I6G8|HECW2_MOUSE E3 ubiquitin-protein ligase HECW2 OS=Mus musculus GN=Hecw2 PE=1 SV=1 570 949 3.0E-119
sp|Q9P2P5|HECW2_HUMAN E3 ubiquitin-protein ligase HECW2 OS=Homo sapiens GN=HECW2 PE=1 SV=2 570 949 4.0E-119
sp|Q76N89|HECW1_HUMAN E3 ubiquitin-protein ligase HECW1 OS=Homo sapiens GN=HECW1 PE=1 SV=3 570 949 1.0E-115
sp|Q8K4P8|HECW1_MOUSE E3 ubiquitin-protein ligase HECW1 OS=Mus musculus GN=Hecw1 PE=1 SV=3 570 949 8.0E-115
sp|Q7Z6Z7|HUWE1_HUMAN E3 ubiquitin-protein ligase HUWE1 OS=Homo sapiens GN=HUWE1 PE=1 SV=3 573 947 5.0E-105
sp|Q7TMY8|HUWE1_MOUSE E3 ubiquitin-protein ligase HUWE1 OS=Mus musculus GN=Huwe1 PE=1 SV=5 573 947 1.0E-104
sp|Q9P4Z1|TOM1_NEUCR E3 ubiquitin-protein ligase TOM1-like OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=B11B22.010 PE=3 SV=4 594 940 9.0E-103
sp|Q756G2|TOM1_ASHGO Probable E3 ubiquitin-protein ligase TOM1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=TOM1 PE=3 SV=2 573 947 3.0E-99
sp|Q8GY23|UPL1_ARATH E3 ubiquitin-protein ligase UPL1 OS=Arabidopsis thaliana GN=UPL1 PE=1 SV=3 560 947 1.0E-97
sp|Q8H0T4|UPL2_ARATH E3 ubiquitin-protein ligase UPL2 OS=Arabidopsis thaliana GN=UPL2 PE=1 SV=3 573 947 4.0E-96
sp|P51593|HUWE1_RAT E3 ubiquitin-protein ligase HUWE1 (Fragment) OS=Rattus norvegicus GN=Huwe1 PE=1 SV=2 630 947 5.0E-96
sp|O13834|PTR1_SCHPO E3 ubiquitin-protein ligase ptr1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ptr1 PE=1 SV=1 573 947 9.0E-96
sp|Q03280|TOM1_YEAST E3 ubiquitin-protein ligase TOM1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TOM1 PE=1 SV=1 596 947 2.0E-92
sp|Q6DCL5|HACE1_XENLA E3 ubiquitin-protein ligase HACE1 OS=Xenopus laevis GN=hace1 PE=2 SV=1 596 940 2.0E-83
sp|Q28BK1|HACE1_XENTR E3 ubiquitin-protein ligase HACE1 OS=Xenopus tropicalis GN=hace1 PE=2 SV=1 596 940 1.0E-82
sp|F8W2M1|HACE1_DANRE E3 ubiquitin-protein ligase HACE1 OS=Danio rerio GN=hace1 PE=3 SV=2 596 941 1.0E-82
sp|E1C656|HACE1_CHICK E3 ubiquitin-protein ligase HACE1 OS=Gallus gallus GN=HACE1 PE=2 SV=1 596 940 2.0E-82
sp|D3ZBM7|HACE1_RAT E3 ubiquitin-protein ligase HACE1 OS=Rattus norvegicus GN=Hace1 PE=3 SV=1 596 940 1.0E-81
sp|F1N6G5|HACE1_BOVIN E3 ubiquitin-protein ligase HACE1 OS=Bos taurus GN=HACE1 PE=3 SV=3 596 940 2.0E-81
sp|Q3U0D9|HACE1_MOUSE E3 ubiquitin-protein ligase HACE1 OS=Mus musculus GN=Hace1 PE=1 SV=1 596 940 2.0E-81
sp|Q8IYU2|HACE1_HUMAN E3 ubiquitin-protein ligase HACE1 OS=Homo sapiens GN=HACE1 PE=1 SV=2 596 940 3.0E-81
sp|Q5U5R9|HECD2_HUMAN Probable E3 ubiquitin-protein ligase HECTD2 OS=Homo sapiens GN=HECTD2 PE=2 SV=2 582 949 2.0E-61
sp|Q5RD78|HECD2_PONAB Probable E3 ubiquitin-protein ligase HECTD2 OS=Pongo abelii GN=HECTD2 PE=2 SV=1 582 949 2.0E-61
sp|Q8CDU6|HECD2_MOUSE Probable E3 ubiquitin-protein ligase HECTD2 OS=Mus musculus GN=Hectd2 PE=1 SV=2 582 949 2.0E-61
sp|O08759|UBE3A_MOUSE Ubiquitin-protein ligase E3A OS=Mus musculus GN=Ube3a PE=1 SV=2 596 947 6.0E-56
sp|Q05086|UBE3A_HUMAN Ubiquitin-protein ligase E3A OS=Homo sapiens GN=UBE3A PE=1 SV=4 596 947 2.0E-55
sp|Q8RWB8|UPL6_ARATH E3 ubiquitin-protein ligase UPL6 OS=Arabidopsis thaliana GN=UPL6 PE=2 SV=1 597 946 2.0E-50
sp|Q5PQN1|HERC4_RAT Probable E3 ubiquitin-protein ligase HERC4 OS=Rattus norvegicus GN=Herc4 PE=2 SV=1 596 946 2.0E-48
sp|Q9SCQ2|UPL7_ARATH E3 ubiquitin-protein ligase UPL7 OS=Arabidopsis thaliana GN=UPL7 PE=2 SV=1 596 946 5.0E-48
sp|Q6PAV2|HERC4_MOUSE Probable E3 ubiquitin-protein ligase HERC4 OS=Mus musculus GN=Herc4 PE=1 SV=2 596 946 3.0E-47
sp|Q9SU29|UPL5_ARATH E3 ubiquitin-protein ligase UPL5 OS=Arabidopsis thaliana GN=UPL5 PE=1 SV=1 598 948 3.0E-47
sp|Q1K9C4|YFK7_SCHPO Probable E3 ubiquitin protein ligase C167.07c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC167.07c PE=2 SV=1 595 947 9.0E-47
sp|O15033|AREL1_HUMAN Apoptosis-resistant E3 ubiquitin protein ligase 1 OS=Homo sapiens GN=AREL1 PE=1 SV=3 574 947 9.0E-46
sp|Q8CHG5|AREL1_MOUSE Apoptosis-resistant E3 ubiquitin protein ligase 1 OS=Mus musculus GN=Arel1 PE=2 SV=2 574 947 1.0E-45
sp|Q15034|HERC3_HUMAN Probable E3 ubiquitin-protein ligase HERC3 OS=Homo sapiens GN=HERC3 PE=1 SV=1 596 946 4.0E-45
sp|Q5GLZ8|HERC4_HUMAN Probable E3 ubiquitin-protein ligase HERC4 OS=Homo sapiens GN=HERC4 PE=1 SV=1 596 946 2.0E-43
sp|Q757T0|HUL4_ASHGO Probable E3 ubiquitin-protein ligase HUL4 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=HUL4 PE=3 SV=1 562 947 2.0E-43
sp|P40985|HUL4_YEAST Probable E3 ubiquitin-protein ligase HUL4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HUL4 PE=1 SV=2 596 947 8.0E-41
sp|Q9UII4|HERC5_HUMAN E3 ISG15--protein ligase HERC5 OS=Homo sapiens GN=HERC5 PE=1 SV=2 596 947 1.0E-40
sp|Q08CZ0|UBE3B_XENTR Ubiquitin-protein ligase E3B OS=Xenopus tropicalis GN=ube3b PE=2 SV=1 595 946 2.0E-40
sp|Q7Z3V4|UBE3B_HUMAN Ubiquitin-protein ligase E3B OS=Homo sapiens GN=UBE3B PE=1 SV=3 595 946 4.0E-40
sp|Q9ES34|UBE3B_MOUSE Ubiquitin-protein ligase E3B OS=Mus musculus GN=Ube3b PE=1 SV=3 595 946 5.0E-40
sp|Q80U95|UBE3C_MOUSE Ubiquitin-protein ligase E3C OS=Mus musculus GN=Ube3c PE=1 SV=2 595 946 1.0E-38
sp|Q15386|UBE3C_HUMAN Ubiquitin-protein ligase E3C OS=Homo sapiens GN=UBE3C PE=1 SV=3 595 946 2.0E-38
sp|F2Z461|HERC6_MOUSE E3 ISG15--protein ligase Herc6 OS=Mus musculus GN=Herc6 PE=2 SV=1 596 946 3.0E-35
sp|P53119|HUL5_YEAST Probable E3 ubiquitin-protein ligase HUL5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HUL5 PE=1 SV=1 598 940 3.0E-35
sp|Q15751|HERC1_HUMAN Probable E3 ubiquitin-protein ligase HERC1 OS=Homo sapiens GN=HERC1 PE=1 SV=2 608 940 7.0E-33
sp|O94275|MUG30_SCHPO Probable E3 ubiquitin-protein ligase mug30 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mug30 PE=1 SV=1 512 947 2.0E-32
sp|Q8IVU3|HERC6_HUMAN Probable E3 ubiquitin-protein ligase HERC6 OS=Homo sapiens GN=HERC6 PE=2 SV=2 596 946 6.0E-32
sp|Q4U2R1|HERC2_MOUSE E3 ubiquitin-protein ligase HERC2 OS=Mus musculus GN=Herc2 PE=1 SV=3 603 940 6.0E-29
sp|O95714|HERC2_HUMAN E3 ubiquitin-protein ligase HERC2 OS=Homo sapiens GN=HERC2 PE=1 SV=2 625 940 3.0E-28
sp|Q14669|TRIPC_HUMAN E3 ubiquitin-protein ligase TRIP12 OS=Homo sapiens GN=TRIP12 PE=1 SV=1 684 942 2.0E-25
sp|F1RCR6|TRIPC_DANRE E3 ubiquitin-protein ligase TRIP12 OS=Danio rerio GN=trip12 PE=3 SV=1 684 942 3.0E-25
sp|E1B7Q7|TRIPC_BOVIN E3 ubiquitin-protein ligase TRIP12 OS=Bos taurus GN=TRIP12 PE=2 SV=2 684 942 4.0E-25
sp|F1LP64|TRIPC_RAT E3 ubiquitin-protein ligase TRIP12 OS=Rattus norvegicus GN=Trip12 PE=1 SV=1 684 942 5.0E-25
sp|G5E870|TRIPC_MOUSE E3 ubiquitin-protein ligase TRIP12 OS=Mus musculus GN=Trip12 PE=1 SV=1 623 942 1.0E-24
sp|B4F6W9|TRIPC_XENTR E3 ubiquitin-protein ligase TRIP12 OS=Xenopus tropicalis GN=trip12 PE=2 SV=1 684 942 2.0E-24
sp|Q9LYZ7|UPL4_ARATH E3 ubiquitin-protein ligase UPL4 OS=Arabidopsis thaliana GN=UPL4 PE=3 SV=1 681 945 3.0E-24
sp|Q6WWW4|UPL3_ARATH E3 ubiquitin-protein ligase UPL3 OS=Arabidopsis thaliana GN=UPL3 PE=1 SV=1 596 945 3.0E-23
sp|Q3U487|HECD3_MOUSE E3 ubiquitin-protein ligase HECTD3 OS=Mus musculus GN=Hectd3 PE=1 SV=2 616 939 3.0E-22
sp|P51592|HYD_DROME E3 ubiquitin-protein ligase hyd OS=Drosophila melanogaster GN=hyd PE=1 SV=3 679 946 6.0E-22
sp|Q5T447|HECD3_HUMAN E3 ubiquitin-protein ligase HECTD3 OS=Homo sapiens GN=HECTD3 PE=1 SV=1 616 939 2.0E-21
sp|Q9VR91|HERC2_DROME Probable E3 ubiquitin-protein ligase HERC2 OS=Drosophila melanogaster GN=HERC2 PE=1 SV=3 604 940 3.0E-21
sp|Q1L8J7|YAP1_DANRE Transcriptional coactivator YAP1 OS=Danio rerio GN=yap1 PE=2 SV=2 447 622 4.0E-21
sp|Q9V853|SMUF1_DROME E3 ubiquitin-protein ligase Smurf1 OS=Drosophila melanogaster GN=lack PE=1 SV=3 136 422 3.0E-20
sp|Q80TP3|UBR5_MOUSE E3 ubiquitin-protein ligase UBR5 OS=Mus musculus GN=Ubr5 PE=1 SV=2 672 947 3.0E-20
sp|Q62671|UBR5_RAT E3 ubiquitin-protein ligase UBR5 OS=Rattus norvegicus GN=Ubr5 PE=1 SV=3 672 947 3.0E-20
sp|O95071|UBR5_HUMAN E3 ubiquitin-protein ligase UBR5 OS=Homo sapiens GN=UBR5 PE=1 SV=2 672 947 4.0E-20
sp|P33202|UFD4_YEAST Ubiquitin fusion degradation protein 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=UFD4 PE=1 SV=1 670 945 2.0E-19
sp|Q9VVI3|NEDD4_DROME E3 ubiquitin-protein ligase Nedd-4 OS=Drosophila melanogaster GN=Nedd4 PE=1 SV=2 121 406 6.0E-19
sp|Q8SSY6|SPKUL_DICDI Bifunctional serine/threonine-protein kinase/NEDD4-like E3 ubiquitin-protein ligase OS=Dictyostelium discoideum GN=DDB_G0276527 PE=3 SV=2 684 947 4.0E-18
sp|Q10435|YDE1_SCHPO Probable ubiquitin fusion degradation protein C12B10.01c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC12B10.01c PE=3 SV=2 514 945 3.0E-17
sp|Q9CUN6|SMUF1_MOUSE E3 ubiquitin-protein ligase SMURF1 OS=Mus musculus GN=Smurf1 PE=2 SV=2 132 383 4.0E-17
sp|Q9ULT8|HECD1_HUMAN E3 ubiquitin-protein ligase HECTD1 OS=Homo sapiens GN=HECTD1 PE=1 SV=3 761 942 5.0E-16
sp|Q2EJA0|YAP1_RAT Transcriptional coactivator YAP1 OS=Rattus norvegicus GN=Yap1 PE=1 SV=1 436 559 6.0E-16
sp|P46938|YAP1_MOUSE Transcriptional coactivator YAP1 OS=Mus musculus GN=Yap1 PE=1 SV=2 464 559 1.0E-15
sp|D6C652|YAP1A_XENLA Transcriptional coactivator YAP1-A OS=Xenopus laevis GN=yap1-a PE=1 SV=1 464 559 1.0E-15
sp|Q9PUN2|SMUF1_XENLA E3 ubiquitin-protein ligase SMURF1 OS=Xenopus laevis GN=smurf1 PE=2 SV=1 132 383 3.0E-15
sp|H2LBU8|YAP1_ORYLA Transcriptional coactivator YAP1 OS=Oryzias latipes GN=yap1 PE=1 SV=2 444 559 4.0E-15
sp|P46937|YAP1_HUMAN Transcriptional coactivator YAP1 OS=Homo sapiens GN=YAP1 PE=1 SV=2 451 559 5.0E-15
sp|Q69ZR2|HECD1_MOUSE E3 ubiquitin-protein ligase HECTD1 OS=Mus musculus GN=Hectd1 PE=1 SV=2 761 942 2.0E-14
sp|Q45VV3|YAP1_DROME Transcriptional coactivator yorkie OS=Drosophila melanogaster GN=yki PE=1 SV=2 467 563 2.0E-13
sp|C6KTB7|ALTH1_PLAF7 Putative E3 ubiquitin-protein ligase protein PFF1365c OS=Plasmodium falciparum (isolate 3D7) GN=PFF1365c PE=3 SV=1 676 941 7.0E-13
sp|Q6I6G8|HECW2_MOUSE E3 ubiquitin-protein ligase HECW2 OS=Mus musculus GN=Hecw2 PE=1 SV=1 354 589 4.0E-12
sp|Q9P2P5|HECW2_HUMAN E3 ubiquitin-protein ligase HECW2 OS=Homo sapiens GN=HECW2 PE=1 SV=2 354 589 4.0E-12
sp|H2LBU8|YAP1_ORYLA Transcriptional coactivator YAP1 OS=Oryzias latipes GN=yap1 PE=1 SV=2 354 529 3.0E-11
sp|Q5F389|WWOX_CHICK WW domain-containing oxidoreductase OS=Gallus gallus GN=WWOX PE=2 SV=2 468 593 9.0E-11
sp|Q8IX03|KIBRA_HUMAN Protein KIBRA OS=Homo sapiens GN=WWC1 PE=1 SV=1 469 559 2.0E-10
sp|Q91WL8|WWOX_MOUSE WW domain-containing oxidoreductase OS=Mus musculus GN=Wwox PE=1 SV=1 468 593 2.0E-10
sp|Q5SXA9|KIBRA_MOUSE Protein KIBRA OS=Mus musculus GN=Wwc1 PE=1 SV=1 469 559 2.0E-10
sp|Q9NZC7|WWOX_HUMAN WW domain-containing oxidoreductase OS=Homo sapiens GN=WWOX PE=1 SV=1 468 593 3.0E-10
sp|A4IIJ3|KIBRA_XENTR Protein KIBRA OS=Xenopus tropicalis GN=wwc1 PE=2 SV=1 469 578 4.0E-10
sp|Q6AWC2|WWC2_HUMAN Protein WWC2 OS=Homo sapiens GN=WWC2 PE=1 SV=2 465 611 7.0E-10
sp|Q6RHR9|MAGI1_MOUSE Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1 OS=Mus musculus GN=Magi1 PE=1 SV=1 467 559 1.0E-09
sp|Q96QZ7|MAGI1_HUMAN Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1 OS=Homo sapiens GN=MAGI1 PE=1 SV=3 467 559 1.0E-09
sp|Q96PU5|NED4L_HUMAN E3 ubiquitin-protein ligase NEDD4-like OS=Homo sapiens GN=NEDD4L PE=1 SV=2 136 421 2.0E-09
sp|Q5R9W5|WWOX_PONAB WW domain-containing oxidoreductase OS=Pongo abelii GN=WWOX PE=2 SV=1 468 593 2.0E-09
sp|Q4L1J4|MAGI1_RAT Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1 OS=Rattus norvegicus GN=Magi1 PE=1 SV=1 467 559 2.0E-09
sp|Q6NXJ0|WWC2_MOUSE Protein WWC2 OS=Mus musculus GN=Wwc2 PE=1 SV=1 465 611 3.0E-09
sp|A1A5G4|MAGI3_XENTR Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 3 OS=Xenopus tropicalis GN=magi3 PE=2 SV=1 469 559 7.0E-09
sp|Q8CFI0|NED4L_MOUSE E3 ubiquitin-protein ligase NEDD4-like OS=Mus musculus GN=Nedd4l PE=1 SV=2 136 384 2.0E-08
sp|Q5F488|MAGI3_CHICK Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 3 OS=Gallus gallus GN=MAGI3 PE=2 SV=1 469 559 3.0E-08
sp|Q6DJR2|WWC2_XENTR Protein WWC2 OS=Xenopus tropicalis GN=wwc2 PE=2 SV=1 465 558 4.0E-08
sp|O88382|MAGI2_RAT Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 2 OS=Rattus norvegicus GN=Magi2 PE=1 SV=1 456 559 5.0E-08
sp|P46937|YAP1_HUMAN Transcriptional coactivator YAP1 OS=Homo sapiens GN=YAP1 PE=1 SV=2 354 528 7.0E-08
sp|Q9JK71|MAGI3_RAT Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 3 OS=Rattus norvegicus GN=Magi3 PE=1 SV=2 469 557 7.0E-08
sp|Q9EQJ9|MAGI3_MOUSE Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 3 OS=Mus musculus GN=Magi3 PE=1 SV=2 469 557 7.0E-08
sp|Q5TCQ9|MAGI3_HUMAN Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 3 OS=Homo sapiens GN=MAGI3 PE=1 SV=2 525 559 8.0E-08
sp|Q9JK71|MAGI3_RAT Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 3 OS=Rattus norvegicus GN=Magi3 PE=1 SV=2 525 559 9.0E-08
sp|Q9EQJ9|MAGI3_MOUSE Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 3 OS=Mus musculus GN=Magi3 PE=1 SV=2 525 559 9.0E-08
sp|Q5F488|MAGI3_CHICK Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 3 OS=Gallus gallus GN=MAGI3 PE=2 SV=1 525 559 1.0E-07
sp|Q9WVQ1|MAGI2_MOUSE Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 2 OS=Mus musculus GN=Magi2 PE=1 SV=2 456 559 1.0E-07
sp|Q86UL8|MAGI2_HUMAN Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 2 OS=Homo sapiens GN=MAGI2 PE=1 SV=3 456 559 2.0E-07
sp|Q6RHR9|MAGI1_MOUSE Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1 OS=Mus musculus GN=Magi1 PE=1 SV=1 525 558 3.0E-07
sp|Q96QZ7|MAGI1_HUMAN Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1 OS=Homo sapiens GN=MAGI1 PE=1 SV=3 525 558 3.0E-07
sp|Q803A8|WWOX_DANRE WW domain-containing oxidoreductase OS=Danio rerio GN=wwox PE=2 SV=1 468 593 3.0E-07
sp|A1A5G4|MAGI3_XENTR Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 3 OS=Xenopus tropicalis GN=magi3 PE=2 SV=1 525 559 5.0E-07
sp|Q6DN14|MCTP1_HUMAN Multiple C2 and transmembrane domain-containing protein 1 OS=Homo sapiens GN=MCTP1 PE=2 SV=2 136 219 6.0E-07
sp|Q5R4J5|SYT1_PONAB Synaptotagmin-1 OS=Pongo abelii GN=SYT1 PE=2 SV=1 130 210 7.0E-07
sp|Q4L1J4|MAGI1_RAT Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1 OS=Rattus norvegicus GN=Magi1 PE=1 SV=1 525 558 9.0E-07
sp|Q8VEB2|SAV1_MOUSE Protein salvador homolog 1 OS=Mus musculus GN=Sav1 PE=1 SV=2 429 570 1.0E-06
sp|Q9H4B6|SAV1_HUMAN Protein salvador homolog 1 OS=Homo sapiens GN=SAV1 PE=1 SV=2 431 570 1.0E-06
sp|A4V8B4|SAV1_RAT Protein salvador homolog 1 OS=Rattus norvegicus GN=Sav1 PE=2 SV=1 429 570 1.0E-06
sp|Q19404|YAP1_CAEEL Yes-associated protein homolog 1 OS=Caenorhabditis elegans GN=yap-1 PE=1 SV=2 520 559 2.0E-06
sp|P46935|NEDD4_MOUSE E3 ubiquitin-protein ligase NEDD4 OS=Mus musculus GN=Nedd4 PE=1 SV=3 298 392 3.0E-06
sp|Q76N89|HECW1_HUMAN E3 ubiquitin-protein ligase HECW1 OS=Homo sapiens GN=HECW1 PE=1 SV=3 338 420 3.0E-06
sp|Q7XA06|SYT3_ARATH Synaptotagmin-3 OS=Arabidopsis thaliana GN=SYT3 PE=2 SV=1 136 211 3.0E-06
sp|B4K6I9|KIBRA_DROMO Protein kibra OS=Drosophila mojavensis GN=Kibra PE=3 SV=1 469 558 3.0E-06
sp|O95817|BAG3_HUMAN BAG family molecular chaperone regulator 3 OS=Homo sapiens GN=BAG3 PE=1 SV=3 527 568 4.0E-06
sp|B4M5X4|KIBRA_DROVI Protein kibra OS=Drosophila virilis GN=Kibra PE=3 SV=1 469 558 6.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0004842 ubiquitin-protein transferase activity Yes
GO:0005515 protein binding Yes
GO:0019787 ubiquitin-like protein transferase activity No
GO:0005488 binding No
GO:0140096 catalytic activity, acting on a protein No
GO:0003824 catalytic activity No
GO:0016740 transferase activity No
GO:0003674 molecular_function No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm 0.6603 0.4267 0.2132 0.2266 0.2098 0.1178 0.154 0.2879 0.2627 0.008

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup1751
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2408
Ophiocordyceps australis map64 (Brazil) OphauB2|7742
Ophiocordyceps camponoti-floridani Ophcf2|00948
Ophiocordyceps camponoti-rufipedis Ophun1|4534
Ophiocordyceps kimflemingae Ophio5|2154 (this protein)
Ophiocordyceps subramaniannii Hirsu2|1629

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|2154
MYSSKTGLACKAPPGARHVRLIAASSFRSCEGAGGSRRFCTASPSRAIRPPPPPPPNACYCLPVHLFASSDADVR
LAVAARSIGPDFLASLLPSTSVVGVVGIFGCLPDDCSRGNSLATVNMAARSESGLPSKANLRVTIIAADGLYKRD
VFRLPDPFAVATINGEQTKTTTVSKRTLNPYWNESFDFRVNEDSILAVQVFDQKKFKKKDQGFLGVINIRVGDVM
HALGADADDQMLTRDLKKSTDNLVVHGKLIINLSCNLNTPARGGQSSGNRPPLSNPGAASASSLAASMADNRPGS
SMSGQNGIVNGAQTTLAHHPASSSSTPNPSASNGSGQSRPISQLSPFEDNQGRLPAGWERREDNLGRTYYVDHNT
RTTSWNRPTASGAAESRSDREAATQVERQRHQNRTLPEDRTGTSSPTLQQQQQQQQGQGQGQGQAQASSNSTGAG
AANTTMMHTGATSPGSGELPSGWEQRWTPEGRPYFVDHNTRTTTWVDPRRQQYIRMYGGQNNANGQIQQQPVSQL
GPLPSGWEMRLTNTARVYFVDHNTKTTTWDDPRLPSSLDQNVPQYKRDFRRKLIYFRSQPAMRILSGQCHIKVRR
SHIFEDSFAEITRQSPMDLKKRLMIKFDGEDGLDYGGLSREFFFLLSHEMFNPFYCLFEYSAHDNYTLQINPHSG
INPEHLNYFKFIGRVVGLAIFHRRFLDAFFIGALYKMVLGKAVTLADMEGVDADFHRSLQWMLDNDISGGILEQT
FSTEDERFGVMTTEDLIPNGRNIDVTNENKKEYVDLMVKWRIEKRIAEQFQAFKEGFQELIPQDLINVFDERELE
LLIGGIAEIDVDDWKKHTDYRGYTESDEVIQNFWQTVRSWDGEQKSRLLQFTTGTSRIPVNGFKDLQGSDGPRRF
TIEKAGEITNLPKAHTCFNRIDLPPYKNMETLQQKLTIAVEETMGFGQE
Coding >Ophio5|2154
ATGTATTCGAGTAAGACCGGCCTAGCCTGCAAGGCCCCGCCCGGAGCTCGTCACGTGCGTCTTATCGCCGCCTCG
TCGTTCCGCTCCTGCGAGGGAGCGGGGGGAAGTCGGCGCTTCTGCACAGCCTCACCTTCTCGGGCCATCCGACCC
CCCCCCCCCCCCCCTCCAAACGCTTGCTATTGCTTACCAGTACACTTGTTCGCCTCGTCGGATGCCGACGTTCGT
CTTGCCGTCGCCGCACGCTCTATCGGTCCTGACTTCCTCGCGTCTCTTCTTCCCTCGACGAGCGTCGTCGGCGTC
GTCGGCATCTTCGGCTGCCTGCCGGACGACTGCTCGAGAGGCAATTCTCTCGCCACTGTTAACATGGCTGCCCGC
TCCGAATCTGGGCTGCCTAGCAAGGCCAACCTGCGCGTCACCATCATCGCCGCCGATGGCCTCTACAAGAGAGAC
GTCTTCCGTCTGCCCGACCCCTTTGCCGTCGCGACGATAAACGGCGAGCAGACGAAGACGACGACGGTCAGCAAA
CGAACACTGAATCCATATTGGAACGAAAGCTTTGACTTCCGCGTGAACGAGGACAGCATCTTGGCCGTCCAGGTC
TTCGACCAGAAGAAGTTTAAGAAGAAGGATCAAGGCTTCCTGGGAGTCATCAATATCAGAGTCGGCGATGTGATG
CACGCGCTTGGAGCCGATGCCGATGATCAGATGCTGACGCGCGACCTGAAAAAGTCGACAGATAATCTCGTCGTC
CACGGAAAGCTAATCATCAACCTCTCTTGCAACCTGAACACACCAGCCAGGGGAGGCCAGTCATCCGGCAATCGA
CCACCCCTTTCTAACCCCGGTGCCGCCAGTGCGTCCTCGCTCGCCGCTTCCATGGCCGACAACCGTCCCGGCTCG
TCCATGTCGGGCCAAAATGGTATCGTCAACGGAGCTCAGACCACCCTGGCTCATCATCCTGCCAGCTCGAGCTCC
ACGCCGAACCCGTCCGCATCCAACGGCTCTGGCCAGTCGCGGCCCATCAGCCAGCTCAGTCCCTTTGAGGACAAT
CAGGGCCGCCTACCGGCTGGCTGGGAGCGACGAGAAGACAACCTAGGTCGTACGTATTACGTTGACCACAACACG
CGAACTACGAGCTGGAACCGGCCAACGGCAAGCGGCGCCGCCGAGTCTCGCAGTGACAGGGAGGCGGCGACTCAG
GTGGAGCGTCAGAGGCATCAAAACCGTACCCTACCGGAGGACAGGACCGGCACCAGCTCGCCGACCCTGCAGCAG
CAGCAGCAGCAGCAGCAGGGGCAGGGGCAGGGGCAGGGGCAAGCTCAGGCCAGCAGCAACAGCACCGGCGCCGGC
GCCGCCAACACTACCATGATGCACACTGGCGCGACCAGCCCTGGCTCCGGGGAGCTCCCCTCCGGTTGGGAGCAG
CGATGGACGCCCGAGGGAAGGCCCTACTTTGTCGACCACAACACCCGAACGACGACCTGGGTCGACCCTCGCCGT
CAGCAGTATATCCGCATGTACGGAGGGCAGAACAATGCAAACGGGCAGATCCAGCAACAGCCCGTTTCGCAGCTC
GGCCCCCTGCCTAGCGGGTGGGAGATGCGGCTCACAAACACGGCGCGAGTCTACTTCGTCGATCACAACACCAAG
ACAACCACGTGGGACGATCCGCGCCTCCCATCTTCACTCGATCAGAATGTGCCTCAGTACAAGCGAGACTTTAGG
CGGAAGCTCATTTACTTCAGGTCTCAGCCGGCGATGCGCATCTTGAGCGGGCAGTGCCACATCAAGGTCCGGCGA
TCGCACATCTTTGAGGATTCTTTCGCCGAAATCACCCGCCAGTCGCCCATGGACCTGAAGAAGCGTCTGATGATC
AAGTTTGATGGAGAAGACGGCCTGGACTACGGCGGTCTTTCTCGAGAGTTCTTCTTCCTCTTGTCCCACGAGATG
TTCAACCCCTTTTACTGCCTGTTCGAGTACTCGGCGCACGACAACTACACTCTGCAGATCAACCCCCACTCCGGC
ATCAATCCGGAGCACTTGAACTACTTCAAGTTCATCGGACGCGTCGTCGGTCTAGCCATCTTCCACCGCCGCTTC
CTGGATGCCTTCTTCATCGGCGCCCTTTACAAGATGGTTCTGGGCAAGGCGGTGACGCTGGCGGACATGGAGGGT
GTCGACGCCGACTTTCACCGGTCGCTCCAGTGGATGCTCGACAACGATATTTCCGGCGGCATCCTGGAACAGACC
TTTTCCACTGAAGACGAGAGGTTCGGAGTCATGACGACTGAAGATCTCATCCCCAACGGCCGAAATATTGACGTG
ACAAACGAGAACAAGAAGGAGTATGTCGACCTCATGGTCAAGTGGCGCATCGAGAAGCGCATCGCGGAGCAGTTC
CAGGCCTTCAAGGAGGGCTTCCAAGAGCTCATCCCTCAAGACCTCATCAATGTCTTTGACGAGCGAGAGCTCGAG
CTGCTCATCGGAGGCATCGCCGAGATTGACGTGGACGATTGGAAGAAGCACACGGACTATCGTGGCTACACCGAA
TCGGACGAGGTCATCCAGAACTTCTGGCAGACCGTCCGCTCTTGGGACGGGGAGCAGAAGTCGCGACTGCTGCAA
TTCACGACGGGCACATCAAGAATCCCGGTCAACGGGTTCAAAGACCTACAGGGCAGCGACGGTCCCCGAAGGTTC
ACCATTGAGAAAGCGGGAGAAATCACAAACCTGCCAAAGGCGCACACGTGCTTCAACCGAATCGATCTGCCTCCG
TATAAGAATATGGAGACGCTGCAACAGAAGCTTACAATCGCCGTGGAAGAGACGATGGGTTTCGGGCAGGAA
Transcript >Ophio5|2154
ATGTATTCGAGTAAGACCGGCCTAGCCTGCAAGGCCCCGCCCGGAGCTCGTCACGTGCGTCTTATCGCCGCCTCG
TCGTTCCGCTCCTGCGAGGGAGCGGGGGGAAGTCGGCGCTTCTGCACAGCCTCACCTTCTCGGGCCATCCGACCC
CCCCCCCCCCCCCCTCCAAACGCTTGCTATTGCTTACCAGTACACTTGTTCGCCTCGTCGGATGCCGACGTTCGT
CTTGCCGTCGCCGCACGCTCTATCGGTCCTGACTTCCTCGCGTCTCTTCTTCCCTCGACGAGCGTCGTCGGCGTC
GTCGGCATCTTCGGCTGCCTGCCGGACGACTGCTCGAGAGGCAATTCTCTCGCCACTGTTAACATGGCTGCCCGC
TCCGAATCTGGGCTGCCTAGCAAGGCCAACCTGCGCGTCACCATCATCGCCGCCGATGGCCTCTACAAGAGAGAC
GTCTTCCGTCTGCCCGACCCCTTTGCCGTCGCGACGATAAACGGCGAGCAGACGAAGACGACGACGGTCAGCAAA
CGAACACTGAATCCATATTGGAACGAAAGCTTTGACTTCCGCGTGAACGAGGACAGCATCTTGGCCGTCCAGGTC
TTCGACCAGAAGAAGTTTAAGAAGAAGGATCAAGGCTTCCTGGGAGTCATCAATATCAGAGTCGGCGATGTGATG
CACGCGCTTGGAGCCGATGCCGATGATCAGATGCTGACGCGCGACCTGAAAAAGTCGACAGATAATCTCGTCGTC
CACGGAAAGCTAATCATCAACCTCTCTTGCAACCTGAACACACCAGCCAGGGGAGGCCAGTCATCCGGCAATCGA
CCACCCCTTTCTAACCCCGGTGCCGCCAGTGCGTCCTCGCTCGCCGCTTCCATGGCCGACAACCGTCCCGGCTCG
TCCATGTCGGGCCAAAATGGTATCGTCAACGGAGCTCAGACCACCCTGGCTCATCATCCTGCCAGCTCGAGCTCC
ACGCCGAACCCGTCCGCATCCAACGGCTCTGGCCAGTCGCGGCCCATCAGCCAGCTCAGTCCCTTTGAGGACAAT
CAGGGCCGCCTACCGGCTGGCTGGGAGCGACGAGAAGACAACCTAGGTCGTACGTATTACGTTGACCACAACACG
CGAACTACGAGCTGGAACCGGCCAACGGCAAGCGGCGCCGCCGAGTCTCGCAGTGACAGGGAGGCGGCGACTCAG
GTGGAGCGTCAGAGGCATCAAAACCGTACCCTACCGGAGGACAGGACCGGCACCAGCTCGCCGACCCTGCAGCAG
CAGCAGCAGCAGCAGCAGGGGCAGGGGCAGGGGCAGGGGCAAGCTCAGGCCAGCAGCAACAGCACCGGCGCCGGC
GCCGCCAACACTACCATGATGCACACTGGCGCGACCAGCCCTGGCTCCGGGGAGCTCCCCTCCGGTTGGGAGCAG
CGATGGACGCCCGAGGGAAGGCCCTACTTTGTCGACCACAACACCCGAACGACGACCTGGGTCGACCCTCGCCGT
CAGCAGTATATCCGCATGTACGGAGGGCAGAACAATGCAAACGGGCAGATCCAGCAACAGCCCGTTTCGCAGCTC
GGCCCCCTGCCTAGCGGGTGGGAGATGCGGCTCACAAACACGGCGCGAGTCTACTTCGTCGATCACAACACCAAG
ACAACCACGTGGGACGATCCGCGCCTCCCATCTTCACTCGATCAGAATGTGCCTCAGTACAAGCGAGACTTTAGG
CGGAAGCTCATTTACTTCAGGTCTCAGCCGGCGATGCGCATCTTGAGCGGGCAGTGCCACATCAAGGTCCGGCGA
TCGCACATCTTTGAGGATTCTTTCGCCGAAATCACCCGCCAGTCGCCCATGGACCTGAAGAAGCGTCTGATGATC
AAGTTTGATGGAGAAGACGGCCTGGACTACGGCGGTCTTTCTCGAGAGTTCTTCTTCCTCTTGTCCCACGAGATG
TTCAACCCCTTTTACTGCCTGTTCGAGTACTCGGCGCACGACAACTACACTCTGCAGATCAACCCCCACTCCGGC
ATCAATCCGGAGCACTTGAACTACTTCAAGTTCATCGGACGCGTCGTCGGTCTAGCCATCTTCCACCGCCGCTTC
CTGGATGCCTTCTTCATCGGCGCCCTTTACAAGATGGTTCTGGGCAAGGCGGTGACGCTGGCGGACATGGAGGGT
GTCGACGCCGACTTTCACCGGTCGCTCCAGTGGATGCTCGACAACGATATTTCCGGCGGCATCCTGGAACAGACC
TTTTCCACTGAAGACGAGAGGTTCGGAGTCATGACGACTGAAGATCTCATCCCCAACGGCCGAAATATTGACGTG
ACAAACGAGAACAAGAAGGAGTATGTCGACCTCATGGTCAAGTGGCGCATCGAGAAGCGCATCGCGGAGCAGTTC
CAGGCCTTCAAGGAGGGCTTCCAAGAGCTCATCCCTCAAGACCTCATCAATGTCTTTGACGAGCGAGAGCTCGAG
CTGCTCATCGGAGGCATCGCCGAGATTGACGTGGACGATTGGAAGAAGCACACGGACTATCGTGGCTACACCGAA
TCGGACGAGGTCATCCAGAACTTCTGGCAGACCGTCCGCTCTTGGGACGGGGAGCAGAAGTCGCGACTGCTGCAA
TTCACGACGGGCACATCAAGAATCCCGGTCAACGGGTTCAAAGACCTACAGGGCAGCGACGGTCCCCGAAGGTTC
ACCATTGAGAAAGCGGGAGAAATCACAAACCTGCCAAAGGCGCACACGTGCTTCAACCGAATCGATCTGCCTCCG
TATAAGAATATGGAGACGCTGCAACAGAAGCTTACAATCGCCGTGGAAGAGACGATGGGTTTCGGGCAGGAATAG
Gene >Ophio5|2154
ATGTATTCGAGTAAGACCGGCCTAGCCTGCAAGGCCCCGCCCGGAGCTCGTCACGTGCGTCTTATCGCCGCCTCG
TCGTTCCGCTCCTGCGAGGGAGCGGGGGGAAGTCGGCGCTTCTGCACAGCCTCACCTTCTCGGGCCATCCGACCC
CCCCCCCCCCCCCCTCCAAACGCTTGCTATTGCTTACCAGTACACTTGTTCGCCTCGTCGGATGCCGACGTTCGT
CTTGCCGTCGCCGCACGCTCTATCGGTCCTGACTTCCTCGCGTCTCTTCTTCCCTCGACGAGCGTCGTCGGCGTC
GTCGGCATCTTCGGCTGCCTGCCGGACGACTGCTCGAGAGGCAATTCTCTCGCCACTGTTAACATGGCTGCCCGC
TCCGAATCTGGGCTGCCTAGGTGAGCATCATCGTGGAATCGATCTCTCTGCCCGCCCGTTCCCGCGGCCCTTTGT
CGTCGATTGCTGACCGCTCCCGCAGCAAGGCCAACCTGCGCGTCACCAGTTCGTTCCCTGAGTCTTTCTCCTTTT
CTTCTTTGTCGTCGCAAGCCTTTGTCTCTTCGTCATCATCTTCCTTGCTGTTCTCTTTCCTGACGGAACTCCCCC
TTCCCCCCCCCGGTCGCGCCTTTGCACTGCTGACGCCACATCAGTCATCGCCGCCGATGGCCTCTACAAGAGAGA
CGTCTTCCGTCCGTGCCCCCCATCTTGCCGCATATGTAAAATGTCACTTCGCTGACGACCTGCCCAGGTCTGCCC
GACCCCTTTGCCGTCGCGACGATAAACGGCGAGCAGACGAAGACGACGACGGTCAGCAAACGAACACTGAATCCA
TATTGGAACGAAAGCTTTGACTTGTAGGAGAGCCCCGCATTTTCTGCTGAGCCTGCCTTGCCTGGCTGGCGTGCT
TACCCTGTGTCGCAGCCGCGTGAACGAGGACAGCATCTTGGCCGTCCAGGTCTTCGACCAGAAGAAGTTTAAGAA
GAAGGATCAAGGCTTCCTGGGAGTCATCAATATCAGAGTCGGCGATGTGATGCACGCGCTTGGAGCCGATGCCGA
TGGTAAGCAGTCACATCGGCAGCGTGGAACCTTGTACCGCCACGTCTCCCGCTCGTTCGACGCCCTGGACAGAGC
CAACCTTGCTGACTGCTTAATCATAGATCAGATGCTGACGCGCGACCTGAAAAAGTCGACAGATAATCTCGTCGT
CCACGGAAAGCTAATCATCAACCTCTCTTGCAACCTGAACACACCAGCCAGGGGAGGCCAGTCATCCGGCAATCG
ACCACCCCTTTCTAACCCCGGTGCCGCCAGTGCGTCCTCGCTCGCCGCTTCCATGGCCGACAACCGTCCCGGCTC
GTCCATGTCGGGCCAAAATGGTATCGTCAACGGAGCTCAGACCACCCTGGCTCATCATCCTGCCAGCTCGAGCTC
CACGCCGAACCCGTCCGCATCCAACGGCTCTGGCCAGTCGCGGCCCATCAGCCAGCTCAGTCCCTTTGAGGACAA
TCAGGGCCGCCTACCGGCTGGCTGGGAGCGACGAGAAGACAACCTAGGTCGTACGTATTACGTTGACCACAACAC
GCGAACTACGAGCTGGAACCGGCCAACGGCAAGCGGCGCCGCCGAGTCTCGCAGTGACAGGGAGGCGGCGACTCA
GGTGGAGCGTCAGAGGCATCAAAACCGTACCCTACCGGAGGACAGGACCGGCACCAGCTCGCCGACCCTGCAGCA
GCAGCAGCAGCAGCAGCAGGGGCAGGGGCAGGGGCAGGGGCAAGCTCAGGCCAGCAGCAACAGCACCGGCGCCGG
CGCCGCCAACACTACCATGATGCACACTGGCGCGACCAGCCCTGGCTCCGGGGAGCTCCCCTCCGGTTGGGAGCA
GCGATGGACGCCCGAGGGAAGGCCCTACTTTGTCGACCACAACACCCGAACGACGACCTGGGTCGACCCTCGCCG
TCAGCAGTATATCCGCATGTACGGAGGGCAGAACAATGCAAACGGGCAGATCCAGCAACAGCCCGTTTCGCAGCT
CGGCCCCCTGCCTAGCGGGTGGGAGATGCGGCTCACAAACACGGCGCGAGTCTACTTCGTCGATCACAACACCAA
GACAACCACGTGGGACGATCCGCGCCTCCCATCTTCACTCGATCAGAATGTGCCTCAGTACAAGCGAGACTTTAG
GCGGAAGCTCATTTACTTCAGGTCTCAGCCGGCGATGCGCATCTTGAGCGGGCAGTGCCACATCAAGGTCCGGCG
ATCGCACATCTTTGAGGATTCTTTCGCCGAAATCACCCGCCAGTCGCCCATGGACCTGAAGAAGCGTCTGATGAT
CAAGTTTGATGGAGAAGACGGCCTGGACTACGGCGGTCTTTCTCGAGAGTTCTTCTTCCTCTTGTCCCACGAGAT
GTTCAACCCCTTTTACTGCCTGTTCGAGTACTCGGCGCACGACAACTACACTCTGCAGATCAACCCCCACTCCGG
CATCAATCCGGAGCACTTGAACTACTTCAAGTTCATCGGACGCGTCGTCGGTCTAGCCATCTTCCACCGCCGCTT
CCTGGATGCCTTCTTCATCGGCGCCCTTTACAAGATGGTTCTGGGCAAGGCGGTGACGCTGGCGGACATGGAGGG
TGTCGACGCCGACTTTCACCGGTCGCTCCAGTGGATGCTCGACAACGATATTTCCGGCGGCATCCTGGAACAGAC
CTTTTCCACTGAAGACGAGAGGTTCGGAGTCATGACGACTGAAGATCTCATCCCCAACGGCCGAAATATTGACGT
GACAAACGAGAACAAGAAGGAGTATGTCGACCTCATGGTCAAGTGGCGCATCGAGAAGCGCATCGCGGAGCAGTT
CCAGGCCTTCAAGGAGGGCTTCCAAGAGCTCATCCCTCAAGACCTCATCAATGTCTTTGACGAGCGAGAGCTCGA
GCTGCTCATCGGAGGCATCGCCGAGATTGACGTGGACGATTGGAAGAAGCACACGGACTATCGTGGCTACACCGA
ATCGGACGAGGTCATCCAGAACTTCTGGCAGACCGTCCGCTCTTGGGACGGGGAGCAGAAGTCGCGACTGCTGCA
ATTCACGACGGGCACATCAAGAATCCCGGTCAACGGGTTCAAAGACCTACAGGGCAGCGACGGTCCCCGAAGGTT
CACCATTGAGAAAGCGGGAGAAATCACAAACCTGCCAAAGGCGCACACGTGGTAAGTCGAGGGGAAAATTGTAAG
CTGACCAAGGTTGGCTTGACTGACACATTGGATAGCTTCAACCGAATCGATCTGCCTCCGTATAAGAATATGGAG
ACGCTGCAACAGAAGCTTACAATCGCCGTGGAAGAGACGATGGGTTTCGGGCAGGAATAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail