Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|2137
Gene name
Locationscaffold_188:3131..6066
Strand+
Gene length (bp)2935
Transcript length (bp)2658
Coding sequence length (bp)2655
Protein length (aa) 885

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF11951 Fungal_trans_2 Fungal specific transcription factor domain 1.8E-17 303 808
PF00172 Zn_clus Fungal Zn(2)-Cys(6) binuclear cluster domain 1.0E-07 37 72

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O74308|YOG2_SCHPO Uncharacterized transcriptional regulatory protein C15D4.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC15D4.02 PE=3 SV=3 32 80 6.0E-15
sp|Q9UT46|MOC3_SCHPO Transcriptional regulatory protein moc3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=moc3 PE=1 SV=4 32 81 1.0E-13
sp|Q5ANB1|WOR2_CANAL White-opaque regulator 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=WOR2 PE=1 SV=1 38 69 7.0E-09
sp|Q9HFR4|ATG2_PICPA Autophagy-related protein 2 OS=Komagataella pastoris GN=ATG2 PE=3 SV=1 33 69 1.0E-08
sp|Q5A4F3|AHR1_CANAL Adhesion and hyphal regulator 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=AHR1 PE=1 SV=1 25 66 4.0E-08
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O74308|YOG2_SCHPO Uncharacterized transcriptional regulatory protein C15D4.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC15D4.02 PE=3 SV=3 32 80 6.0E-15
sp|Q9UT46|MOC3_SCHPO Transcriptional regulatory protein moc3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=moc3 PE=1 SV=4 32 81 1.0E-13
sp|Q5ANB1|WOR2_CANAL White-opaque regulator 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=WOR2 PE=1 SV=1 38 69 7.0E-09
sp|Q9HFR4|ATG2_PICPA Autophagy-related protein 2 OS=Komagataella pastoris GN=ATG2 PE=3 SV=1 33 69 1.0E-08
sp|Q5A4F3|AHR1_CANAL Adhesion and hyphal regulator 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=AHR1 PE=1 SV=1 25 66 4.0E-08
sp|Q59QC7|UPC2_CANAL Sterol uptake control protein 2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=UPC2 PE=1 SV=1 3 69 2.0E-06
sp|P05085|ARGR2_YEAST Arginine metabolism regulation protein II OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ARG81 PE=1 SV=3 26 79 4.0E-06
sp|Q05958|ECM22_YEAST Sterol regulatory element-binding protein ECM22 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ECM22 PE=1 SV=1 28 66 6.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0006355 regulation of transcription, DNA-templated Yes
GO:0008270 zinc ion binding Yes
GO:0000981 DNA-binding transcription factor activity, RNA polymerase II-specific Yes
GO:0008150 biological_process No
GO:0051252 regulation of RNA metabolic process No
GO:0060255 regulation of macromolecule metabolic process No
GO:0019222 regulation of metabolic process No
GO:0050794 regulation of cellular process No
GO:0140110 transcription regulator activity No
GO:0031323 regulation of cellular metabolic process No
GO:0065007 biological regulation No
GO:0046872 metal ion binding No
GO:0010468 regulation of gene expression No
GO:0043167 ion binding No
GO:0043169 cation binding No
GO:0003674 molecular_function No
GO:0019219 regulation of nucleobase-containing compound metabolic process No
GO:0051171 regulation of nitrogen compound metabolic process No
GO:0005488 binding No
GO:0080090 regulation of primary metabolic process No
GO:0009889 regulation of biosynthetic process No
GO:0050789 regulation of biological process No
GO:0003700 DNA-binding transcription factor activity No
GO:1903506 regulation of nucleic acid-templated transcription No
GO:2001141 regulation of RNA biosynthetic process No
GO:0046914 transition metal ion binding No
GO:0010556 regulation of macromolecule biosynthetic process No
GO:0031326 regulation of cellular biosynthetic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 35 0.45

Transmembrane Domains

(None)

Transcription Factor Class

Transcription Factor Class
(based on PFAM domains)
Fungal Specific TF

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|2137
MAATASVNRLEHMASLHDNDRDDPKGKKPAIKKRTKTGCLTCRKRRIKCDENKPRCKNCIKSKRECEGYNQRVVF
KDPMGAQQSHYTPALYPTAMPYLGDPLTSHHAKPAAQMPLQAIAPKPSPYDFGQQQMVTPQQHANLDSFSHAHLS
APLHSSIPNPLLAPSFAPDHEHSLYDLGPHYDHVSRHHNFVNSDQGPTDAHRPLAIDDAPFSLPNDGLPRVPNID
YDAIFSEDDAYLAESDDDHPDPRGLMAPGISHMPWPCQITNGSQVRTFSAFAREQALSEYMNFAPNSELRNHAMR
TIFMHFISVTGPSMSLYERDPPPNTELGQFDHNADVGNNLFSYTFPVLSLNHPGLLHAIMAIASLQIAKIQGTPA
TAALKHYHLSIRRIAKNVRSPLRRTKLSTLAATLLLAYFEVWSSDHTKWCSHLFGARLLFREIALRDMSRICLPA
KRLRWSTGLGIGEASSDLDYQLLSVITGTRISAEDYGLGDGPPLDQRCLYLTDKDLEQYDILRDLFWWYGKMDVY
QSILGGTKLFMEYDAWTQCPPRGPFSDIHAIYGTYDHLILLLGRLASFTAKDLARKRKANRNPHTSTSGGSPPHF
PGIVPTYGKFRVPMGFSPEMGHSPPQTDPNDDSEAPHSLEAAEHEWDSIRQGFEALESHLSPQFQHLNGEYTDRM
ETPFGSALQYRTYSIAGIWMNYYMGLIHLYRSRPNMPPAAMQAAQVAAPSTAGYAIQIGRIAAGLAEDCSRTVDL
STTLAAAFIESCFCLFVAAVQLQNNDQRCWVVQRMYDISRLTGWQSAKKIANGCESAWLKAYQLGHGPEYKRPDN
LDDVPVSVWMLPRRLDRRISELDEREETRLVLVRSEQTNLAFGLLGVEGDLDRIELADDS
Coding >Ophio5|2137
ATGGCGGCCACCGCCAGCGTCAACCGGCTGGAGCACATGGCCTCTCTTCACGACAATGATCGGGACGATCCCAAA
GGCAAGAAGCCGGCCATCAAGAAGAGGACAAAGACGGGATGTCTGACCTGTCGCAAGCGCCGTATCAAGTGCGAC
GAAAACAAGCCGAGGTGCAAGAACTGCATCAAGTCGAAGCGCGAATGCGAAGGCTACAACCAGAGAGTCGTCTTC
AAAGACCCCATGGGCGCCCAGCAAAGCCACTACACGCCCGCCCTCTACCCAACCGCCATGCCCTATCTCGGCGAT
CCCTTGACCTCGCACCATGCGAAGCCGGCGGCGCAGATGCCCCTACAAGCCATCGCACCCAAGCCATCGCCCTAC
GACTTCGGCCAGCAGCAGATGGTGACTCCCCAACAGCACGCGAACCTTGATAGTTTTAGCCATGCTCACCTCTCC
GCTCCCTTGCACTCGTCAATCCCGAACCCGCTGCTTGCCCCGAGCTTCGCGCCCGATCATGAACACAGCCTCTAC
GACCTTGGCCCTCACTATGATCATGTTTCCCGCCATCACAACTTCGTAAACAGCGATCAAGGGCCAACCGACGCA
CACCGCCCTCTCGCCATTGATGACGCTCCCTTTTCCCTCCCCAACGACGGACTCCCGCGCGTCCCGAATATTGAC
TATGACGCCATCTTCTCCGAAGACGATGCCTACTTGGCAGAGTCGGACGACGACCATCCAGACCCTCGTGGGCTC
ATGGCGCCGGGCATCAGCCACATGCCTTGGCCGTGCCAGATCACCAATGGATCTCAGGTCAGGACCTTCTCAGCC
TTCGCCCGGGAGCAAGCCCTGTCCGAGTACATGAACTTTGCGCCAAACTCGGAGCTGCGAAATCATGCCATGCGC
ACCATATTCATGCACTTCATCAGCGTCACGGGTCCCTCCATGTCGCTGTACGAACGAGATCCGCCTCCGAACACG
GAGCTGGGGCAGTTTGACCACAATGCCGACGTGGGAAACAACCTCTTCAGCTACACGTTTCCCGTCCTCTCGCTG
AACCATCCGGGGCTGCTTCACGCCATCATGGCCATCGCAAGCTTGCAGATCGCCAAGATTCAGGGCACTCCCGCC
ACGGCAGCCTTGAAGCACTACCACTTGTCGATTCGCAGGATAGCCAAGAACGTCAGGTCGCCGCTGCGGAGGACG
AAGTTGTCGACGCTGGCCGCCACGCTGCTGCTCGCCTACTTCGAAGTCTGGTCGTCGGACCACACGAAATGGTGC
AGCCACCTCTTTGGGGCCCGGCTCCTGTTTCGCGAAATCGCCCTCAGAGACATGTCGCGGATCTGTCTTCCCGCT
AAGCGGCTCCGCTGGTCGACGGGTCTCGGCATAGGCGAAGCATCGAGTGACTTGGACTACCAGCTGTTGAGCGTC
ATAACGGGCACTCGAATTTCTGCCGAGGATTACGGCCTGGGGGACGGCCCGCCACTCGACCAGCGATGCCTCTAT
CTGACGGACAAGGATCTTGAGCAATACGACATTCTTCGCGATCTATTCTGGTGGTACGGCAAGATGGACGTGTAT
CAGAGCATATTGGGGGGTACCAAATTATTCATGGAATATGACGCGTGGACGCAATGCCCTCCGAGAGGGCCCTTT
TCGGACATTCACGCCATCTACGGCACTTACGACCATCTCATTCTACTGCTCGGCCGCCTCGCCAGCTTCACGGCG
AAGGACCTGGCGCGCAAGCGCAAGGCAAACCGAAACCCTCATACGAGCACCAGCGGAGGTTCGCCACCCCATTTT
CCGGGAATCGTCCCAACTTACGGCAAGTTTCGCGTTCCCATGGGCTTCAGCCCCGAGATGGGCCATTCGCCACCA
CAGACGGACCCGAATGACGATTCCGAAGCACCCCACAGCCTAGAGGCTGCTGAGCACGAGTGGGACAGCATCCGG
CAAGGATTCGAGGCCCTAGAGAGCCACCTGAGCCCCCAGTTTCAACATCTGAACGGCGAGTACACGGATCGGATG
GAGACGCCCTTTGGGTCCGCCCTGCAATATCGCACTTATTCGATTGCGGGTATCTGGATGAACTACTACATGGGT
TTGATTCACCTGTACCGGAGCCGTCCAAATATGCCGCCGGCAGCCATGCAGGCGGCCCAGGTGGCGGCTCCTTCG
ACGGCCGGCTACGCCATCCAGATTGGGCGAATCGCCGCAGGGCTGGCCGAAGACTGTTCGCGGACGGTGGACTTG
AGCACGACGCTGGCGGCGGCCTTTATCGAGAGCTGCTTCTGCCTCTTCGTGGCAGCCGTGCAGCTCCAGAACAAC
GATCAGCGGTGCTGGGTGGTGCAGCGCATGTACGACATATCACGGCTGACGGGGTGGCAGTCGGCCAAGAAGATT
GCCAACGGATGCGAGTCGGCCTGGCTCAAGGCTTACCAGCTCGGACACGGGCCCGAGTACAAACGACCTGACAAC
CTGGATGACGTGCCAGTGTCGGTGTGGATGCTGCCTCGGCGGCTGGACCGGAGGATTTCGGAGCTGGACGAGAGG
GAGGAGACGCGGCTCGTGCTGGTCAGGTCGGAGCAGACAAACCTGGCCTTTGGGCTGCTGGGGGTGGAGGGCGAC
TTGGATCGCATCGAACTCGCCGATGACAGC
Transcript >Ophio5|2137
ATGGCGGCCACCGCCAGCGTCAACCGGCTGGAGCACATGGCCTCTCTTCACGACAATGATCGGGACGATCCCAAA
GGCAAGAAGCCGGCCATCAAGAAGAGGACAAAGACGGGATGTCTGACCTGTCGCAAGCGCCGTATCAAGTGCGAC
GAAAACAAGCCGAGGTGCAAGAACTGCATCAAGTCGAAGCGCGAATGCGAAGGCTACAACCAGAGAGTCGTCTTC
AAAGACCCCATGGGCGCCCAGCAAAGCCACTACACGCCCGCCCTCTACCCAACCGCCATGCCCTATCTCGGCGAT
CCCTTGACCTCGCACCATGCGAAGCCGGCGGCGCAGATGCCCCTACAAGCCATCGCACCCAAGCCATCGCCCTAC
GACTTCGGCCAGCAGCAGATGGTGACTCCCCAACAGCACGCGAACCTTGATAGTTTTAGCCATGCTCACCTCTCC
GCTCCCTTGCACTCGTCAATCCCGAACCCGCTGCTTGCCCCGAGCTTCGCGCCCGATCATGAACACAGCCTCTAC
GACCTTGGCCCTCACTATGATCATGTTTCCCGCCATCACAACTTCGTAAACAGCGATCAAGGGCCAACCGACGCA
CACCGCCCTCTCGCCATTGATGACGCTCCCTTTTCCCTCCCCAACGACGGACTCCCGCGCGTCCCGAATATTGAC
TATGACGCCATCTTCTCCGAAGACGATGCCTACTTGGCAGAGTCGGACGACGACCATCCAGACCCTCGTGGGCTC
ATGGCGCCGGGCATCAGCCACATGCCTTGGCCGTGCCAGATCACCAATGGATCTCAGGTCAGGACCTTCTCAGCC
TTCGCCCGGGAGCAAGCCCTGTCCGAGTACATGAACTTTGCGCCAAACTCGGAGCTGCGAAATCATGCCATGCGC
ACCATATTCATGCACTTCATCAGCGTCACGGGTCCCTCCATGTCGCTGTACGAACGAGATCCGCCTCCGAACACG
GAGCTGGGGCAGTTTGACCACAATGCCGACGTGGGAAACAACCTCTTCAGCTACACGTTTCCCGTCCTCTCGCTG
AACCATCCGGGGCTGCTTCACGCCATCATGGCCATCGCAAGCTTGCAGATCGCCAAGATTCAGGGCACTCCCGCC
ACGGCAGCCTTGAAGCACTACCACTTGTCGATTCGCAGGATAGCCAAGAACGTCAGGTCGCCGCTGCGGAGGACG
AAGTTGTCGACGCTGGCCGCCACGCTGCTGCTCGCCTACTTCGAAGTCTGGTCGTCGGACCACACGAAATGGTGC
AGCCACCTCTTTGGGGCCCGGCTCCTGTTTCGCGAAATCGCCCTCAGAGACATGTCGCGGATCTGTCTTCCCGCT
AAGCGGCTCCGCTGGTCGACGGGTCTCGGCATAGGCGAAGCATCGAGTGACTTGGACTACCAGCTGTTGAGCGTC
ATAACGGGCACTCGAATTTCTGCCGAGGATTACGGCCTGGGGGACGGCCCGCCACTCGACCAGCGATGCCTCTAT
CTGACGGACAAGGATCTTGAGCAATACGACATTCTTCGCGATCTATTCTGGTGGTACGGCAAGATGGACGTGTAT
CAGAGCATATTGGGGGGTACCAAATTATTCATGGAATATGACGCGTGGACGCAATGCCCTCCGAGAGGGCCCTTT
TCGGACATTCACGCCATCTACGGCACTTACGACCATCTCATTCTACTGCTCGGCCGCCTCGCCAGCTTCACGGCG
AAGGACCTGGCGCGCAAGCGCAAGGCAAACCGAAACCCTCATACGAGCACCAGCGGAGGTTCGCCACCCCATTTT
CCGGGAATCGTCCCAACTTACGGCAAGTTTCGCGTTCCCATGGGCTTCAGCCCCGAGATGGGCCATTCGCCACCA
CAGACGGACCCGAATGACGATTCCGAAGCACCCCACAGCCTAGAGGCTGCTGAGCACGAGTGGGACAGCATCCGG
CAAGGATTCGAGGCCCTAGAGAGCCACCTGAGCCCCCAGTTTCAACATCTGAACGGCGAGTACACGGATCGGATG
GAGACGCCCTTTGGGTCCGCCCTGCAATATCGCACTTATTCGATTGCGGGTATCTGGATGAACTACTACATGGGT
TTGATTCACCTGTACCGGAGCCGTCCAAATATGCCGCCGGCAGCCATGCAGGCGGCCCAGGTGGCGGCTCCTTCG
ACGGCCGGCTACGCCATCCAGATTGGGCGAATCGCCGCAGGGCTGGCCGAAGACTGTTCGCGGACGGTGGACTTG
AGCACGACGCTGGCGGCGGCCTTTATCGAGAGCTGCTTCTGCCTCTTCGTGGCAGCCGTGCAGCTCCAGAACAAC
GATCAGCGGTGCTGGGTGGTGCAGCGCATGTACGACATATCACGGCTGACGGGGTGGCAGTCGGCCAAGAAGATT
GCCAACGGATGCGAGTCGGCCTGGCTCAAGGCTTACCAGCTCGGACACGGGCCCGAGTACAAACGACCTGACAAC
CTGGATGACGTGCCAGTGTCGGTGTGGATGCTGCCTCGGCGGCTGGACCGGAGGATTTCGGAGCTGGACGAGAGG
GAGGAGACGCGGCTCGTGCTGGTCAGGTCGGAGCAGACAAACCTGGCCTTTGGGCTGCTGGGGGTGGAGGGCGAC
TTGGATCGCATCGAACTCGCCGATGACAGCTGA
Gene >Ophio5|2137
ATGGCGGCCACCGCCAGCGTCAACCGGCTGGAGCACATGGCCTCTCTTCACGACAATGATCGGGACGATCCCAAA
GGCAAGAAGCCGGCCATCAAGAAGAGGACAAAGACGGGATGTCTGAGTGAGTGTGGCCCAGCAGCTACCCTCGCC
GAGGCTACGCCCAACCCTCTGCTGTCCTCTGCCTGACCTCACGACCGCAGCCTGTCGCAAGCGCCGTATCAAGTG
CGACGAAAACAAGCCGAGGTGCAAGAACTGCATCAAGTCGAAGCGCGAATGCGAAGGCTACAACCAGAGAGTCGT
CTTCAAAGACCCCATGGGCGCCCAGCAAAGCCACTACACGCCCGCCCTCTACCCAACCGCCATGCCCTATCTCGG
CGATCCCTTGACCTCGCACCATGCGAAGCCGGCGGCGCAGATGCCCCTACAAGCCATCGCACCCAAGCCATCGCC
CTACGACTTCGGCCAGCAGCAGATGGTGACTCCCCAACAGCACGCGAACCTTGATAGTTTTAGCCATGCTCACCT
CTCCGCTCCCTTGCACTCGTCAATCCCGAACCCGCTGCTTGCCCCGAGCTTCGCGCCCGATCATGAACACAGCCT
CTACGACCTTGGCCCTCACTATGATCATGTTTCCCGCCATCACAACTTCGTAAACAGCGATCAAGGGCCAACCGA
CGCACACCGCCCTCTCGCCATTGATGACGCTCCCTTTTCCCTCCCCAACGACGGACTCCCGCGCGTCCCGAATAT
TGACTATGACGCCATCTTCTCCGAAGACGATGCCTACTTGGCAGAGTCGGACGACGACCATCCAGACCCTCGTGG
GCTCATGGCGCCGGGCATCAGCCACATGCCTTGGCCGTGCCAGATCACCAATGGATCTCAGGTCAGGACCTTCTC
AGCCTTCGCCCGGGAGCAAGCCCTGTCCGAGTACATGAACTTTGCGCCAAACTCGGAGCTGCGAAATCATGCCAT
GCGCACCATATTCATGCACTTCATCAGCGTCACGGGTCCCTCCATGTCGCTGTACGAACGAGATCCGCCTCCGAA
CACGGAGCTGGGGCAGTTTGACCACAATGCCGACGTGGGAAACAACCTCTTCAGCTGTAAGTCTCCTACTCGCGA
CCTGTCCTTCGCCGGCAGCTGACCGCGCAGACACGTTTCCCGTCCTCTCGCTGAACCATCCGGGGCTGCTTCACG
CCATCATGGCCATCGCAAGCTTGCAGATCGCCAAGATTCAGGGCACTCCCGCCACGGCAGCCTTGAAGCACTACC
ACTTGTCGATTCGCAGGATAGCCAAGAACGTCAGGTCGCCGCTGCGGAGGACGAAGTTGTCGACGCTGGCCGCCA
CGCTGCTGCTCGCCTACTTCGAAGTCTGGTCGTCGGACCACACGAAATGGTGCAGCCACCTCTTTGGGGCCCGGC
TCCTGTTTCGCGAAATCGCCCTCAGAGACATGTCGCGGATCTGTCTTCCCGCTAAGCGGCTCCGCTGGTCGACGG
GTCTCGGCATAGGCGAAGCATCGAGTGACTTGGACTACCAGCTGTTGAGCGTCATAACGGGCACTCGAATTTCTG
CCGAGGATTACGGCCTGGGGGACGGCCCGCCACTCGACCAGCGATGCCTCTATCTGACGGACAAGGATCTTGAGC
AATACGACATTCTTCGCGATCTATTCTGGTGGTACGGCAAGATGGACGTGTATCAGAGCATATTGGGGGGTACCA
AATTATTGTATGCCCACGAGCTTCGTCGACAAACTCTAGTCTGACGAGGCACAGCATGGAATATGACGCGTGGAC
GCAATGCCCTCCGAGAGGGCCCTTTTCGGACATTCACGCCATGTACGCTGAAGCTCGCTTTTCTTTACTTCATTG
GGCTGACCCGGATCACAGCTACGGCACTTACGACCATCTCATTCTACTGCTCGGCCGCCTCGCCAGCTTCACGGC
GAAGGACCTGGCGCGCAAGCGCAAGGCAAACCGAAACCCTCATACGAGCACCAGCGGAGGTTCGCCACCCCATTT
TCCGGGAATCGTCCCAACTTACGGCAAGTTTCGCGTTCCCATGGGCTTCAGCCCCGAGATGGGCCATTCGCCACC
ACAGACGGACCCGAATGACGATTCCGAAGCACCCCACAGCCTAGAGGCTGCTGAGCACGAGTGGGACAGCATCCG
GCAAGGATTCGAGGCCCTAGAGAGCCACCTGAGCCCCCAGTTTCAACATCTGAACGGCGAGTACACGGATCGGAT
GGAGACGCCCTTTGGGTCCGCCCTGCAATATCGCACTTATTCGATTGCGGGTATCTGGATGAACTACTACATGGG
TTTGATTCACCTGTACCGGAGCCGTCCAAATATGCCGCCGGCAGCCATGCAGGCGGCCCAGGTGGCGGCTCCTTC
GACGGCCGGCTACGCCATCCAGATTGGGCGAATCGCCGCAGGGCTGGCCGAAGACTGTTCGCGGACGGTGGACTT
GAGCACGACGCTGGCGGCGGCCTTTATCGAGAGCTGCTTCTGCCTCTTCGTGGCAGCCGTGCAGGTGAGCCGGCT
GGTATCGTGTGTGTCCGGTTCGTGACTAACAAGGCGGCAGCTCCAGAACAACGATCAGCGGTGCTGGGTGGTGCA
GCGCATGTACGACATATCACGGCTGACGGGGTGGCAGTCGGCCAAGAAGATTGCCAACGGATGCGAGTCGGCCTG
GCTCAAGGCTTACCAGCTCGGACACGGGCCCGAGTACAAACGACCTGACAACCTGGATGACGTGCCAGTGTCGGT
GTGGATGCTGCCTCGGCGGCTGGACCGGAGGATTTCGGAGCTGGACGAGAGGGAGGAGACGCGGCTCGTGCTGGT
CAGGTCGGAGCAGACAAACCTGGCCTTTGGGCTGCTGGGGGTGGAGGGCGACTTGGATCGCATCGAACTCGCCGA
TGACAGCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail