Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|2133
Gene name
Locationscaffold_187:29684..30671
Strand-
Gene length (bp)987
Transcript length (bp)987
Coding sequence length (bp)984
Protein length (aa) 328

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04616 Glyco_hydro_43 Glycosyl hydrolases family 43 3.0E-32 31 321

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P94489|XYNB_BACSU Beta-xylosidase OS=Bacillus subtilis (strain 168) GN=xynB PE=1 SV=2 39 312 5.0E-08
sp|Q2U1X8|ABNC_ASPOR Probable arabinan endo-1,5-alpha-L-arabinosidase C OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=abnC PE=3 SV=1 40 301 1.0E-07
sp|B8NMD3|ABNC_ASPFN Probable arabinan endo-1,5-alpha-L-arabinosidase C OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=abnC PE=3 SV=2 40 301 1.0E-07
sp|A5AAG2|ABNC_ASPNC Probable arabinan endo-1,5-alpha-L-arabinosidase C OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=abnC PE=3 SV=1 40 136 1.0E-06
sp|A5IKD4|EABN_THEP1 Extracellular endo-alpha-(1->5)-L-arabinanase OS=Thermotoga petrophila (strain RKU-1 / ATCC BAA-488 / DSM 13995) GN=Tpet_0637 PE=1 SV=1 40 303 5.0E-06

GO

GO Term Description Terminal node
GO:0004553 hydrolase activity, hydrolyzing O-glycosyl compounds Yes
GO:0005975 carbohydrate metabolic process Yes
GO:0016787 hydrolase activity No
GO:0071704 organic substance metabolic process No
GO:0044238 primary metabolic process No
GO:0003824 catalytic activity No
GO:0008150 biological_process No
GO:0003674 molecular_function No
GO:0008152 metabolic process No
GO:0016798 hydrolase activity, acting on glycosyl bonds No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Extracellular Signal peptide 0.0957 0.0463 0.964 0.0873 0.0834 0.0364 0.3697 0.3154 0.2143 0.0255

SignalP

SignalP signal predicted Location Score
Yes 1 - 20 0.999708

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

CAZyme category E-value Start End
GH43_30 3.2E-89 37 313

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
SC16a Pure fungal culture 0.05 0.0 0.34
CcL In ants, during behavior modification 0.40 0.0 1.03
CcD In ants, recently dead 0.36 0.0 0.99

Differential expression

Label1 Label2 Q-value Significant difference
SC16a CcL 1.0 no
SC16a CcD 1.0 no
CcL CcD 1.0 no

Orthologs

Orthofinder run ID4
Orthogroup5465
Change Orthofinder run
Species Protein ID
Ophiocordyceps camponoti-floridani Ophcf2|01656
Ophiocordyceps camponoti-rufipedis Ophun1|2989
Ophiocordyceps kimflemingae Ophio5|2133 (this protein)
Ophiocordyceps subramaniannii Hirsu2|6322

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|2133
MLLELGAVVALGWLSTLAEAAAHIRVADAYKPAIHKDFPDPSIVQGTDGLYYAFGTTGGEPVVQVQAARASSPTG
PWRRLLHTNILPNSGPLFTGQNTWAPDVQKLDDGSYVMYFSGQLVNNPDHHCVGAATSRSILGPYTPQSQAFACD
LSVGGQIDPSGFRDTDGRRYVVYKVDGNSLGNGGQCKNGVEPRKPTPIMLQEVGPNGIDKVGEPVQVLDRVGDEP
LVEAPDLYRSSDGTYILFFSSGCFTDPSYNVHYATSRSVKGPYTRASQPLLVSGDSRGLVAPGGASVLAGGNTMV
FHANCDTGRCMYVKRFRYRADMVRLLVG
Coding >Ophio5|2133
ATGTTGCTCGAGCTCGGTGCGGTGGTGGCCCTCGGCTGGCTCTCGACTCTGGCCGAGGCAGCAGCTCACATCCGG
GTCGCCGACGCCTACAAGCCGGCCATACACAAGGACTTCCCCGACCCCAGCATCGTCCAGGGCACCGACGGCCTC
TACTATGCCTTTGGCACCACCGGAGGCGAACCGGTCGTCCAAGTCCAGGCCGCCCGCGCAAGCTCCCCGACCGGG
CCTTGGAGACGACTCCTCCACACCAACATACTGCCCAACTCGGGTCCGCTCTTCACCGGACAGAATACGTGGGCG
CCCGACGTTCAGAAGCTAGACGACGGCTCGTACGTCATGTACTTTAGCGGTCAGCTCGTCAACAACCCGGACCAC
CACTGCGTCGGAGCCGCCACCAGCCGCAGCATCTTGGGCCCTTATACGCCCCAGTCCCAGGCCTTTGCCTGTGAC
CTCAGCGTCGGCGGCCAGATCGACCCGTCCGGCTTCCGGGACACAGACGGGAGGCGATACGTCGTCTACAAGGTC
GACGGAAACAGCCTGGGAAACGGCGGCCAGTGCAAGAACGGCGTCGAGCCGCGGAAGCCGACGCCCATCATGCTA
CAGGAGGTCGGTCCCAACGGCATCGACAAGGTGGGAGAGCCCGTCCAAGTCCTGGACCGCGTCGGCGATGAGCCC
CTGGTCGAGGCGCCGGACCTCTATCGGAGCTCGGACGGGACGTACATCTTGTTCTTCAGCTCCGGCTGCTTCACG
GACCCGAGCTACAACGTCCACTACGCGACTTCTCGCAGCGTCAAGGGGCCTTATACGCGCGCCTCGCAGCCCCTG
CTCGTCTCTGGCGACAGTCGGGGCCTGGTAGCCCCTGGCGGCGCCTCCGTCCTGGCCGGAGGAAACACCATGGTC
TTCCACGCCAACTGCGACACGGGGAGATGCATGTACGTGAAACGATTCAGATACCGGGCAGACATGGTCAGGTTA
TTAGTGGGA
Transcript >Ophio5|2133
ATGTTGCTCGAGCTCGGTGCGGTGGTGGCCCTCGGCTGGCTCTCGACTCTGGCCGAGGCAGCAGCTCACATCCGG
GTCGCCGACGCCTACAAGCCGGCCATACACAAGGACTTCCCCGACCCCAGCATCGTCCAGGGCACCGACGGCCTC
TACTATGCCTTTGGCACCACCGGAGGCGAACCGGTCGTCCAAGTCCAGGCCGCCCGCGCAAGCTCCCCGACCGGG
CCTTGGAGACGACTCCTCCACACCAACATACTGCCCAACTCGGGTCCGCTCTTCACCGGACAGAATACGTGGGCG
CCCGACGTTCAGAAGCTAGACGACGGCTCGTACGTCATGTACTTTAGCGGTCAGCTCGTCAACAACCCGGACCAC
CACTGCGTCGGAGCCGCCACCAGCCGCAGCATCTTGGGCCCTTATACGCCCCAGTCCCAGGCCTTTGCCTGTGAC
CTCAGCGTCGGCGGCCAGATCGACCCGTCCGGCTTCCGGGACACAGACGGGAGGCGATACGTCGTCTACAAGGTC
GACGGAAACAGCCTGGGAAACGGCGGCCAGTGCAAGAACGGCGTCGAGCCGCGGAAGCCGACGCCCATCATGCTA
CAGGAGGTCGGTCCCAACGGCATCGACAAGGTGGGAGAGCCCGTCCAAGTCCTGGACCGCGTCGGCGATGAGCCC
CTGGTCGAGGCGCCGGACCTCTATCGGAGCTCGGACGGGACGTACATCTTGTTCTTCAGCTCCGGCTGCTTCACG
GACCCGAGCTACAACGTCCACTACGCGACTTCTCGCAGCGTCAAGGGGCCTTATACGCGCGCCTCGCAGCCCCTG
CTCGTCTCTGGCGACAGTCGGGGCCTGGTAGCCCCTGGCGGCGCCTCCGTCCTGGCCGGAGGAAACACCATGGTC
TTCCACGCCAACTGCGACACGGGGAGATGCATGTACGTGAAACGATTCAGATACCGGGCAGACATGGTCAGGTTA
TTAGTGGGATAG
Gene >Ophio5|2133
ATGTTGCTCGAGCTCGGTGCGGTGGTGGCCCTCGGCTGGCTCTCGACTCTGGCCGAGGCAGCAGCTCACATCCGG
GTCGCCGACGCCTACAAGCCGGCCATACACAAGGACTTCCCCGACCCCAGCATCGTCCAGGGCACCGACGGCCTC
TACTATGCCTTTGGCACCACCGGAGGCGAACCGGTCGTCCAAGTCCAGGCCGCCCGCGCAAGCTCCCCGACCGGG
CCTTGGAGACGACTCCTCCACACCAACATACTGCCCAACTCGGGTCCGCTCTTCACCGGACAGAATACGTGGGCG
CCCGACGTTCAGAAGCTAGACGACGGCTCGTACGTCATGTACTTTAGCGGTCAGCTCGTCAACAACCCGGACCAC
CACTGCGTCGGAGCCGCCACCAGCCGCAGCATCTTGGGCCCTTATACGCCCCAGTCCCAGGCCTTTGCCTGTGAC
CTCAGCGTCGGCGGCCAGATCGACCCGTCCGGCTTCCGGGACACAGACGGGAGGCGATACGTCGTCTACAAGGTC
GACGGAAACAGCCTGGGAAACGGCGGCCAGTGCAAGAACGGCGTCGAGCCGCGGAAGCCGACGCCCATCATGCTA
CAGGAGGTCGGTCCCAACGGCATCGACAAGGTGGGAGAGCCCGTCCAAGTCCTGGACCGCGTCGGCGATGAGCCC
CTGGTCGAGGCGCCGGACCTCTATCGGAGCTCGGACGGGACGTACATCTTGTTCTTCAGCTCCGGCTGCTTCACG
GACCCGAGCTACAACGTCCACTACGCGACTTCTCGCAGCGTCAAGGGGCCTTATACGCGCGCCTCGCAGCCCCTG
CTCGTCTCTGGCGACAGTCGGGGCCTGGTAGCCCCTGGCGGCGCCTCCGTCCTGGCCGGAGGAAACACCATGGTC
TTCCACGCCAACTGCGACACGGGGAGATGCATGTACGTGAAACGATTCAGATACCGGGCAGACATGGTCAGGTTA
TTAGTGGGATAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail