Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|2133
Gene name
Locationscaffold_187:29684..30671
Strand-
Gene length (bp)987
Transcript length (bp)987
Coding sequence length (bp)984
Protein length (aa) 328

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04616 Glyco_hydro_43 Glycosyl hydrolases family 43 3.0E-32 31 321

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P94489|XYNB_BACSU Beta-xylosidase OS=Bacillus subtilis (strain 168) GN=xynB PE=1 SV=2 39 312 5.0E-08
sp|Q2U1X8|ABNC_ASPOR Probable arabinan endo-1,5-alpha-L-arabinosidase C OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=abnC PE=3 SV=1 40 301 1.0E-07
sp|B8NMD3|ABNC_ASPFN Probable arabinan endo-1,5-alpha-L-arabinosidase C OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=abnC PE=3 SV=2 40 301 1.0E-07
sp|A5AAG2|ABNC_ASPNC Probable arabinan endo-1,5-alpha-L-arabinosidase C OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=abnC PE=3 SV=1 40 136 1.0E-06
sp|A5IKD4|EABN_THEP1 Extracellular endo-alpha-(1->5)-L-arabinanase OS=Thermotoga petrophila (strain RKU-1 / ATCC BAA-488 / DSM 13995) GN=Tpet_0637 PE=1 SV=1 40 303 5.0E-06

GO

GO Term Description Terminal node
GO:0004553 hydrolase activity, hydrolyzing O-glycosyl compounds Yes
GO:0005975 carbohydrate metabolic process Yes
GO:0016787 hydrolase activity No
GO:0071704 organic substance metabolic process No
GO:0044238 primary metabolic process No
GO:0003824 catalytic activity No
GO:0008150 biological_process No
GO:0003674 molecular_function No
GO:0008152 metabolic process No
GO:0016798 hydrolase activity, acting on glycosyl bonds No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 21 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|2133
MLLELGAVVALGWLSTLAEAAAHIRVADAYKPAIHKDFPDPSIVQGTDGLYYAFGTTGGEPVVQVQAARASSPTG
PWRRLLHTNILPNSGPLFTGQNTWAPDVQKLDDGSYVMYFSGQLVNNPDHHCVGAATSRSILGPYTPQSQAFACD
LSVGGQIDPSGFRDTDGRRYVVYKVDGNSLGNGGQCKNGVEPRKPTPIMLQEVGPNGIDKVGEPVQVLDRVGDEP
LVEAPDLYRSSDGTYILFFSSGCFTDPSYNVHYATSRSVKGPYTRASQPLLVSGDSRGLVAPGGASVLAGGNTMV
FHANCDTGRCMYVKRFRYRADMVRLLVG
Coding >Ophio5|2133
ATGTTGCTCGAGCTCGGTGCGGTGGTGGCCCTCGGCTGGCTCTCGACTCTGGCCGAGGCAGCAGCTCACATCCGG
GTCGCCGACGCCTACAAGCCGGCCATACACAAGGACTTCCCCGACCCCAGCATCGTCCAGGGCACCGACGGCCTC
TACTATGCCTTTGGCACCACCGGAGGCGAACCGGTCGTCCAAGTCCAGGCCGCCCGCGCAAGCTCCCCGACCGGG
CCTTGGAGACGACTCCTCCACACCAACATACTGCCCAACTCGGGTCCGCTCTTCACCGGACAGAATACGTGGGCG
CCCGACGTTCAGAAGCTAGACGACGGCTCGTACGTCATGTACTTTAGCGGTCAGCTCGTCAACAACCCGGACCAC
CACTGCGTCGGAGCCGCCACCAGCCGCAGCATCTTGGGCCCTTATACGCCCCAGTCCCAGGCCTTTGCCTGTGAC
CTCAGCGTCGGCGGCCAGATCGACCCGTCCGGCTTCCGGGACACAGACGGGAGGCGATACGTCGTCTACAAGGTC
GACGGAAACAGCCTGGGAAACGGCGGCCAGTGCAAGAACGGCGTCGAGCCGCGGAAGCCGACGCCCATCATGCTA
CAGGAGGTCGGTCCCAACGGCATCGACAAGGTGGGAGAGCCCGTCCAAGTCCTGGACCGCGTCGGCGATGAGCCC
CTGGTCGAGGCGCCGGACCTCTATCGGAGCTCGGACGGGACGTACATCTTGTTCTTCAGCTCCGGCTGCTTCACG
GACCCGAGCTACAACGTCCACTACGCGACTTCTCGCAGCGTCAAGGGGCCTTATACGCGCGCCTCGCAGCCCCTG
CTCGTCTCTGGCGACAGTCGGGGCCTGGTAGCCCCTGGCGGCGCCTCCGTCCTGGCCGGAGGAAACACCATGGTC
TTCCACGCCAACTGCGACACGGGGAGATGCATGTACGTGAAACGATTCAGATACCGGGCAGACATGGTCAGGTTA
TTAGTGGGA
Transcript >Ophio5|2133
ATGTTGCTCGAGCTCGGTGCGGTGGTGGCCCTCGGCTGGCTCTCGACTCTGGCCGAGGCAGCAGCTCACATCCGG
GTCGCCGACGCCTACAAGCCGGCCATACACAAGGACTTCCCCGACCCCAGCATCGTCCAGGGCACCGACGGCCTC
TACTATGCCTTTGGCACCACCGGAGGCGAACCGGTCGTCCAAGTCCAGGCCGCCCGCGCAAGCTCCCCGACCGGG
CCTTGGAGACGACTCCTCCACACCAACATACTGCCCAACTCGGGTCCGCTCTTCACCGGACAGAATACGTGGGCG
CCCGACGTTCAGAAGCTAGACGACGGCTCGTACGTCATGTACTTTAGCGGTCAGCTCGTCAACAACCCGGACCAC
CACTGCGTCGGAGCCGCCACCAGCCGCAGCATCTTGGGCCCTTATACGCCCCAGTCCCAGGCCTTTGCCTGTGAC
CTCAGCGTCGGCGGCCAGATCGACCCGTCCGGCTTCCGGGACACAGACGGGAGGCGATACGTCGTCTACAAGGTC
GACGGAAACAGCCTGGGAAACGGCGGCCAGTGCAAGAACGGCGTCGAGCCGCGGAAGCCGACGCCCATCATGCTA
CAGGAGGTCGGTCCCAACGGCATCGACAAGGTGGGAGAGCCCGTCCAAGTCCTGGACCGCGTCGGCGATGAGCCC
CTGGTCGAGGCGCCGGACCTCTATCGGAGCTCGGACGGGACGTACATCTTGTTCTTCAGCTCCGGCTGCTTCACG
GACCCGAGCTACAACGTCCACTACGCGACTTCTCGCAGCGTCAAGGGGCCTTATACGCGCGCCTCGCAGCCCCTG
CTCGTCTCTGGCGACAGTCGGGGCCTGGTAGCCCCTGGCGGCGCCTCCGTCCTGGCCGGAGGAAACACCATGGTC
TTCCACGCCAACTGCGACACGGGGAGATGCATGTACGTGAAACGATTCAGATACCGGGCAGACATGGTCAGGTTA
TTAGTGGGATAG
Gene >Ophio5|2133
ATGTTGCTCGAGCTCGGTGCGGTGGTGGCCCTCGGCTGGCTCTCGACTCTGGCCGAGGCAGCAGCTCACATCCGG
GTCGCCGACGCCTACAAGCCGGCCATACACAAGGACTTCCCCGACCCCAGCATCGTCCAGGGCACCGACGGCCTC
TACTATGCCTTTGGCACCACCGGAGGCGAACCGGTCGTCCAAGTCCAGGCCGCCCGCGCAAGCTCCCCGACCGGG
CCTTGGAGACGACTCCTCCACACCAACATACTGCCCAACTCGGGTCCGCTCTTCACCGGACAGAATACGTGGGCG
CCCGACGTTCAGAAGCTAGACGACGGCTCGTACGTCATGTACTTTAGCGGTCAGCTCGTCAACAACCCGGACCAC
CACTGCGTCGGAGCCGCCACCAGCCGCAGCATCTTGGGCCCTTATACGCCCCAGTCCCAGGCCTTTGCCTGTGAC
CTCAGCGTCGGCGGCCAGATCGACCCGTCCGGCTTCCGGGACACAGACGGGAGGCGATACGTCGTCTACAAGGTC
GACGGAAACAGCCTGGGAAACGGCGGCCAGTGCAAGAACGGCGTCGAGCCGCGGAAGCCGACGCCCATCATGCTA
CAGGAGGTCGGTCCCAACGGCATCGACAAGGTGGGAGAGCCCGTCCAAGTCCTGGACCGCGTCGGCGATGAGCCC
CTGGTCGAGGCGCCGGACCTCTATCGGAGCTCGGACGGGACGTACATCTTGTTCTTCAGCTCCGGCTGCTTCACG
GACCCGAGCTACAACGTCCACTACGCGACTTCTCGCAGCGTCAAGGGGCCTTATACGCGCGCCTCGCAGCCCCTG
CTCGTCTCTGGCGACAGTCGGGGCCTGGTAGCCCCTGGCGGCGCCTCCGTCCTGGCCGGAGGAAACACCATGGTC
TTCCACGCCAACTGCGACACGGGGAGATGCATGTACGTGAAACGATTCAGATACCGGGCAGACATGGTCAGGTTA
TTAGTGGGATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail