Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|2123
Gene name
Locationscaffold_187:6239..7991
Strand-
Gene length (bp)1752
Transcript length (bp)1701
Coding sequence length (bp)1698
Protein length (aa) 566

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12999 PRKCSH-like Glucosidase II beta subunit-like 4.4E-12 18 77
PF12999 PRKCSH-like Glucosidase II beta subunit-like 9.1E-25 95 203
PF13015 PRKCSH_1 Glucosidase II beta subunit-like protein 1.8E-26 398 545

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P0CT24|GLU2B_USTMA Glucosidase 2 subunit beta OS=Ustilago maydis (strain 521 / FGSC 9021) GN=UMAG_12045 PE=3 SV=1 42 544 4.0E-46
sp|Q9USH8|GLU2B_SCHPO Glucosidase 2 subunit beta OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gtb1 PE=1 SV=1 5 544 1.0E-41
sp|P14314|GLU2B_HUMAN Glucosidase 2 subunit beta OS=Homo sapiens GN=PRKCSH PE=1 SV=2 24 217 7.0E-23
sp|Q28034|GLU2B_BOVIN Glucosidase 2 subunit beta OS=Bos taurus GN=PRKCSH PE=2 SV=1 24 203 4.0E-22
sp|O08795|GLU2B_MOUSE Glucosidase 2 subunit beta OS=Mus musculus GN=Prkcsh PE=1 SV=1 24 223 5.0E-22
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P0CT24|GLU2B_USTMA Glucosidase 2 subunit beta OS=Ustilago maydis (strain 521 / FGSC 9021) GN=UMAG_12045 PE=3 SV=1 42 544 4.0E-46
sp|Q9USH8|GLU2B_SCHPO Glucosidase 2 subunit beta OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gtb1 PE=1 SV=1 5 544 1.0E-41
sp|P14314|GLU2B_HUMAN Glucosidase 2 subunit beta OS=Homo sapiens GN=PRKCSH PE=1 SV=2 24 217 7.0E-23
sp|Q28034|GLU2B_BOVIN Glucosidase 2 subunit beta OS=Bos taurus GN=PRKCSH PE=2 SV=1 24 203 4.0E-22
sp|O08795|GLU2B_MOUSE Glucosidase 2 subunit beta OS=Mus musculus GN=Prkcsh PE=1 SV=1 24 223 5.0E-22
sp|Q9FM96|PSL4_ARATH Glucosidase 2 subunit beta OS=Arabidopsis thaliana GN=PSL4 PE=2 SV=1 26 206 7.0E-21
sp|Q5NBP9|GLU2B_ORYSJ Glucosidase 2 subunit beta OS=Oryza sativa subsp. japonica GN=Os01g0276800 PE=2 SV=1 14 187 5.0E-15
sp|A2WNF5|GLU2B_ORYSI Glucosidase 2 subunit beta OS=Oryza sativa subsp. indica GN=OsI_01383 PE=3 SV=1 14 187 5.0E-15
sp|Q04924|GLU2B_YEAST Glucosidase 2 subunit beta OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GTB1 PE=1 SV=1 40 317 1.0E-13
sp|Q28034|GLU2B_BOVIN Glucosidase 2 subunit beta OS=Bos taurus GN=PRKCSH PE=2 SV=1 388 540 3.0E-10
sp|O08795|GLU2B_MOUSE Glucosidase 2 subunit beta OS=Mus musculus GN=Prkcsh PE=1 SV=1 385 540 5.0E-10
sp|Q9FM96|PSL4_ARATH Glucosidase 2 subunit beta OS=Arabidopsis thaliana GN=PSL4 PE=2 SV=1 353 544 5.0E-10
sp|P14314|GLU2B_HUMAN Glucosidase 2 subunit beta OS=Homo sapiens GN=PRKCSH PE=1 SV=2 392 538 2.0E-09
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 21 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|2123
MQQRLTCLTLVGAFSILAAAGQLPRGVGPEFASHYEGSGSEFSCISDRSVKLDRARINDNSCDCADGSDEPGTAA
CALIDALSPEQPLPGTPSGSTNASRTLPGFWCENKGHVGSYVPFQYVNDGVCDYDVCCDGSEEFGGRVVCENRCA
AIGREHRKLQEERRLGMERALKKKATMLTEAAQLRRQAESRLTQLAADIKKLEAKRDEAKRKQAEAELADQSRVV
GGGGGGGKVGVLVELARKRVDELRGSLDAVRRHRTTLRGQVDELQAILSTLKADYNPNFNDEGVKAAVKAFEDFA
ARGDAAPEQAADADVDELVKEDGAESGINWAEFESQTEEDTDILLRLEAYLPETLRKAVRSRMLDLRLWLIRNGI
LADKASTGTESQLVKAAREAAETAEREVKDKIREQDEQREDVKKDYGPSDVLRSLRGRSISIDSGEYTYELSWLG
QTLQKSIKGHGDTNMGEFAGIDREMVDDEERLDGKSLGKGLRMVLRYEDGLGCWNGPRRRTDVWLGCAETEELWR
VTEAEKCVYKMEVGTPAACEGGDDDDDDDDDDGKRKRKDEL
Coding >Ophio5|2123
ATGCAGCAGCGACTAACCTGTCTGACGCTCGTGGGCGCCTTTTCCATTCTGGCCGCTGCGGGTCAGCTGCCGCGT
GGCGTTGGCCCTGAATTCGCATCCCATTACGAAGGATCCGGCTCCGAATTCAGCTGTATCAGCGACCGTTCGGTT
AAGCTGGATCGAGCACGAATCAACGACAACAGCTGCGACTGCGCCGATGGCTCCGACGAGCCCGGCACGGCTGCT
TGCGCCCTGATCGATGCGCTTTCTCCAGAGCAACCGCTGCCGGGGACGCCATCCGGAAGCACCAATGCGAGCAGG
ACGCTGCCGGGCTTCTGGTGCGAGAACAAGGGCCACGTGGGCAGCTACGTGCCATTCCAATACGTCAACGATGGC
GTCTGCGACTATGACGTCTGTTGCGACGGGAGCGAGGAGTTTGGAGGACGGGTCGTGTGTGAGAACCGATGCGCC
GCCATTGGGCGGGAGCACCGCAAGCTGCAGGAAGAAAGGCGTCTCGGCATGGAGCGCGCGCTGAAGAAGAAGGCG
ACCATGCTGACCGAGGCGGCTCAGCTGCGTCGTCAGGCCGAGTCTCGCCTGACGCAGCTGGCGGCCGATATTAAG
AAGCTCGAGGCCAAGAGGGACGAGGCCAAGAGGAAGCAGGCTGAGGCCGAGCTGGCGGATCAGAGCCGGGTCGTC
GGTGGAGGAGGAGGAGGAGGCAAGGTCGGCGTGCTCGTCGAGTTGGCGAGGAAGAGGGTCGACGAGCTGCGAGGC
TCCCTCGACGCCGTCCGTCGGCACAGGACGACGCTGCGGGGTCAGGTCGACGAGCTGCAGGCGATACTGTCGACG
CTCAAGGCCGACTACAATCCCAATTTCAACGACGAGGGCGTCAAGGCGGCCGTCAAGGCGTTTGAGGATTTCGCA
GCCCGCGGGGATGCGGCGCCGGAGCAGGCGGCGGACGCGGATGTCGATGAGCTGGTCAAGGAGGACGGGGCCGAG
AGTGGCATCAACTGGGCCGAGTTTGAGTCCCAGACGGAGGAGGATACGGACATTTTGTTGAGGCTCGAGGCCTAC
CTCCCCGAAACCTTGCGCAAGGCGGTCCGCAGCAGGATGCTAGACCTGAGGCTCTGGCTCATCCGCAACGGCATC
CTCGCCGACAAGGCCTCGACGGGGACGGAATCGCAGCTGGTCAAGGCAGCGCGCGAAGCAGCCGAGACGGCGGAG
CGGGAGGTCAAAGACAAGATCAGGGAGCAAGACGAGCAAAGGGAAGACGTGAAGAAGGACTACGGGCCGTCGGAC
GTGCTCCGATCTCTTCGCGGACGAAGCATCAGCATCGATTCCGGCGAATACACGTACGAGCTGAGCTGGCTGGGC
CAGACGCTACAGAAGTCGATAAAGGGCCACGGCGACACCAACATGGGCGAGTTCGCCGGCATCGACCGGGAAATG
GTCGACGACGAGGAGAGGCTCGACGGCAAGAGCCTGGGCAAGGGGCTGCGGATGGTGCTGCGGTACGAGGACGGA
CTGGGATGCTGGAACGGGCCGCGCAGGAGGACGGATGTTTGGCTGGGCTGTGCCGAGACGGAGGAGCTTTGGAGA
GTGACGGAGGCGGAGAAGTGTGTTTACAAGATGGAGGTCGGGACGCCGGCGGCTTGTGAGGGGGGGGATGATGAT
GATGATGATGATGATGATGATGGGAAGAGGAAGAGGAAGGATGAGCTG
Transcript >Ophio5|2123
ATGCAGCAGCGACTAACCTGTCTGACGCTCGTGGGCGCCTTTTCCATTCTGGCCGCTGCGGGTCAGCTGCCGCGT
GGCGTTGGCCCTGAATTCGCATCCCATTACGAAGGATCCGGCTCCGAATTCAGCTGTATCAGCGACCGTTCGGTT
AAGCTGGATCGAGCACGAATCAACGACAACAGCTGCGACTGCGCCGATGGCTCCGACGAGCCCGGCACGGCTGCT
TGCGCCCTGATCGATGCGCTTTCTCCAGAGCAACCGCTGCCGGGGACGCCATCCGGAAGCACCAATGCGAGCAGG
ACGCTGCCGGGCTTCTGGTGCGAGAACAAGGGCCACGTGGGCAGCTACGTGCCATTCCAATACGTCAACGATGGC
GTCTGCGACTATGACGTCTGTTGCGACGGGAGCGAGGAGTTTGGAGGACGGGTCGTGTGTGAGAACCGATGCGCC
GCCATTGGGCGGGAGCACCGCAAGCTGCAGGAAGAAAGGCGTCTCGGCATGGAGCGCGCGCTGAAGAAGAAGGCG
ACCATGCTGACCGAGGCGGCTCAGCTGCGTCGTCAGGCCGAGTCTCGCCTGACGCAGCTGGCGGCCGATATTAAG
AAGCTCGAGGCCAAGAGGGACGAGGCCAAGAGGAAGCAGGCTGAGGCCGAGCTGGCGGATCAGAGCCGGGTCGTC
GGTGGAGGAGGAGGAGGAGGCAAGGTCGGCGTGCTCGTCGAGTTGGCGAGGAAGAGGGTCGACGAGCTGCGAGGC
TCCCTCGACGCCGTCCGTCGGCACAGGACGACGCTGCGGGGTCAGGTCGACGAGCTGCAGGCGATACTGTCGACG
CTCAAGGCCGACTACAATCCCAATTTCAACGACGAGGGCGTCAAGGCGGCCGTCAAGGCGTTTGAGGATTTCGCA
GCCCGCGGGGATGCGGCGCCGGAGCAGGCGGCGGACGCGGATGTCGATGAGCTGGTCAAGGAGGACGGGGCCGAG
AGTGGCATCAACTGGGCCGAGTTTGAGTCCCAGACGGAGGAGGATACGGACATTTTGTTGAGGCTCGAGGCCTAC
CTCCCCGAAACCTTGCGCAAGGCGGTCCGCAGCAGGATGCTAGACCTGAGGCTCTGGCTCATCCGCAACGGCATC
CTCGCCGACAAGGCCTCGACGGGGACGGAATCGCAGCTGGTCAAGGCAGCGCGCGAAGCAGCCGAGACGGCGGAG
CGGGAGGTCAAAGACAAGATCAGGGAGCAAGACGAGCAAAGGGAAGACGTGAAGAAGGACTACGGGCCGTCGGAC
GTGCTCCGATCTCTTCGCGGACGAAGCATCAGCATCGATTCCGGCGAATACACGTACGAGCTGAGCTGGCTGGGC
CAGACGCTACAGAAGTCGATAAAGGGCCACGGCGACACCAACATGGGCGAGTTCGCCGGCATCGACCGGGAAATG
GTCGACGACGAGGAGAGGCTCGACGGCAAGAGCCTGGGCAAGGGGCTGCGGATGGTGCTGCGGTACGAGGACGGA
CTGGGATGCTGGAACGGGCCGCGCAGGAGGACGGATGTTTGGCTGGGCTGTGCCGAGACGGAGGAGCTTTGGAGA
GTGACGGAGGCGGAGAAGTGTGTTTACAAGATGGAGGTCGGGACGCCGGCGGCTTGTGAGGGGGGGGATGATGAT
GATGATGATGATGATGATGATGGGAAGAGGAAGAGGAAGGATGAGCTGTAG
Gene >Ophio5|2123
ATGCAGCAGCGACTAACCTGTCTGACGCTCGTGGGCGCCTTTTCCATTCTGGCCGCTGCGGGTCAGCTGCCGCGT
GGCGTTGGCCCTGAATTCGCATCCCATTACGAAGGATCCGGCTCCGAATTCAGCTGTATCAGCGACCGTTCGGTT
AAGCTGGATCGAGCACGAATCAACGACAACAGCTGCGACTGCGCCGATGGCTCCGACGAGCCCGGCACGGCTGCT
TGCGCCCTGATCGATGCGCTTTCTCCAGAGCAACCGCTGCCGGGGACGCCATCCGGAAGCACCAATGCGAGCAGG
ACGCTGCCGGGCTTCTGGTGCGAGAACAAGGGCCACGTGGGCAGCTACGTGCCATTCCAATACGTCAACGATGGC
GTCTGCGACTATGACGTCTGTTGCGACGGGAGCGAGGAGTTTGGAGGACGGGTCGTGTGTGAGAACCGATGCGCC
GCCATTGGGCGGGAGCACCGCAAGCTGCAGGAAGAAAGGCGTCTCGGCATGGAGCGCGCGCTGAAGAAGAAGGCG
ACCATGCTGACCGAGGCGGCTCAGCTGCGTCGTCAGGCCGAGTCTCGCCTGACGCAGCTGGCGGCCGATATTAAG
AAGCTCGAGGCCAAGAGGGACGAGGCCAAGAGGAAGCAGGCTGAGGCCGAGCTGGCGGATCAGAGCCGGGTCGTC
GGTGGAGGAGGAGGAGGAGGCAAGGTCGGCGTGCTCGTCGAGTTGGCGAGGAAGAGGGTCGACGAGCTGCGAGGC
TCCCTCGACGCCGTCCGTCGGCACAGGACGACGCTGCGGGGTCAGGTCGACGAGCTGCAGGCGATACTGTCGACG
CTCAAGGCCGACTACAATCCCAATTTCAACGACGAGGGCGTCAAGGCGGCCGTCAAGGCGTTTGAGGATTTCGCA
GCCCGCGGGGATGCGGCGCCGGAGCAGGCGGCGGACGCGGATGTCGATGAGCTGGTCAAGGAGGACGGGGCCGAG
AGTGGCATCAACTGGGCCGAGTTTGAGTCCCAGACGGAGGAGGATACGGACATTTGTGAGCGCATTCTGTCTTTT
TTTCCATGGCATGCTTCTGACCAGCCGCCAGTGTTGAGGCTCGAGGCCTACCTCCCCGAAACCTTGCGCAAGGCG
GTCCGCAGCAGGATGCTAGACCTGAGGCTCTGGCTCATCCGCAACGGCATCCTCGCCGACAAGGCCTCGACGGGG
ACGGAATCGCAGCTGGTCAAGGCAGCGCGCGAAGCAGCCGAGACGGCGGAGCGGGAGGTCAAAGACAAGATCAGG
GAGCAAGACGAGCAAAGGGAAGACGTGAAGAAGGACTACGGGCCGTCGGACGTGCTCCGATCTCTTCGCGGACGA
AGCATCAGCATCGATTCCGGCGAATACACGTACGAGCTGAGCTGGCTGGGCCAGACGCTACAGAAGTCGATAAAG
GGCCACGGCGACACCAACATGGGCGAGTTCGCCGGCATCGACCGGGAAATGGTCGACGACGAGGAGAGGCTCGAC
GGCAAGAGCCTGGGCAAGGGGCTGCGGATGGTGCTGCGGTACGAGGACGGACTGGGATGCTGGAACGGGCCGCGC
AGGAGGACGGATGTTTGGCTGGGCTGTGCCGAGACGGAGGAGCTTTGGAGAGTGACGGAGGCGGAGAAGTGTGTT
TACAAGATGGAGGTCGGGACGCCGGCGGCTTGTGAGGGGGGGGATGATGATGATGATGATGATGATGATGATGGG
AAGAGGAAGAGGAAGGATGAGCTGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail