Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|2121
Gene name
Locationscaffold_187:2342..3777
Strand-
Gene length (bp)1435
Transcript length (bp)1176
Coding sequence length (bp)1173
Protein length (aa) 391

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 20 0.5

Transmembrane Domains

Domain # Start End Length
1 27 49 22
2 61 83 22
3 105 127 22
4 140 162 22
5 189 211 22
6 224 246 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|2121
MAQNLTAEVASLLPPPTTINDTHKVYGVAIACAVMSGVATSVVLWRLYLRYASRAFGLDDWATIPALILYLGWSI
LAVYVNLAGGIGKPLWEITLGEYATWFKGFVASSWMYTSMTAAIRVAILLFYRRIFSQTVSWLRVTIYVLLSLQA
VYVIVYSILPALACHPFDSAWNPFERRAHCDDWYFYYDQVALYSTSMVFDLVLLLLPLEPARRLQMRRSKKAGVI
VMFILGAGASIVTAVKLGIFVTDMNGYSEFDPYFARYQLVYFLPAQMSHNGLTFWLPSHVEPTVALIGASLPGLR
PALNVMSASVSQRLRSLYYSRGTSRSDSRAVQGRTWAGHELDDKTVGSTASSRRRDRGFDITRIIETKISSETAH
GSQVQLGQYPAPHPTQ
Coding >Ophio5|2121
ATGGCACAAAACTTGACGGCCGAAGTTGCTTCGTTGCTGCCGCCACCGACGACGATCAATGATACGCACAAGGTC
TATGGAGTTGCTATTGCCTGTGCCGTCATGAGTGGCGTTGCTACCTCGGTTGTTTTGTGGCGTTTATACTTGAGA
TACGCTTCGCGGGCTTTCGGCCTTGATGACTGGGCCACCATTCCCGCCCTCATTCTATATCTTGGTTGGTCCATA
CTGGCCGTCTATGTGAACCTCGCCGGAGGCATCGGAAAGCCCCTGTGGGAAATCACACTCGGCGAGTACGCGACC
TGGTTCAAGGGCTTTGTCGCGTCATCCTGGATGTACACATCCATGACGGCCGCCATCCGAGTCGCCATCTTGCTC
TTCTACCGCCGCATCTTTTCACAAACCGTCTCGTGGCTGAGGGTGACGATCTACGTGCTGCTATCTCTCCAGGCC
GTCTATGTCATCGTCTATTCCATCCTTCCGGCCCTGGCCTGCCATCCGTTCGACAGCGCCTGGAACCCGTTCGAA
CGTCGTGCCCACTGCGACGACTGGTACTTTTACTATGACCAGGTGGCTCTTTACAGCACCAGCATGGTCTTCGAC
CTCGTGCTCTTGCTTCTTCCCCTCGAGCCGGCTCGGAGGCTTCAAATGCGTCGGAGCAAGAAAGCTGGCGTTATC
GTCATGTTCATTCTGGGAGCTGGCGCGAGCATCGTCACTGCAGTCAAACTGGGAATTTTCGTAACCGACATGAAC
GGCTATTCCGAGTTTGATCCTTACTTCGCCCGCTACCAACTCGTCTACTTCCTCCCGGCCCAGATGTCACACAAC
GGCTTGACCTTTTGGCTTCCATCGCACGTCGAGCCAACAGTAGCCCTCATAGGGGCCTCCCTGCCGGGCCTGCGA
CCGGCGCTCAACGTCATGAGCGCCAGCGTCTCGCAGAGGCTGAGGTCGCTCTATTATTCGCGCGGCACCAGCAGG
AGCGACAGCCGAGCCGTACAAGGAAGAACATGGGCCGGCCACGAGTTAGATGACAAGACGGTTGGATCGACGGCT
TCGAGCCGGCGACGAGACCGTGGCTTCGATATTACGCGCATCATCGAGACCAAGATCAGCTCCGAGACAGCGCAC
GGAAGCCAAGTTCAGCTGGGACAGTATCCGGCGCCCCATCCGACTCAA
Transcript >Ophio5|2121
ATGGCACAAAACTTGACGGCCGAAGTTGCTTCGTTGCTGCCGCCACCGACGACGATCAATGATACGCACAAGGTC
TATGGAGTTGCTATTGCCTGTGCCGTCATGAGTGGCGTTGCTACCTCGGTTGTTTTGTGGCGTTTATACTTGAGA
TACGCTTCGCGGGCTTTCGGCCTTGATGACTGGGCCACCATTCCCGCCCTCATTCTATATCTTGGTTGGTCCATA
CTGGCCGTCTATGTGAACCTCGCCGGAGGCATCGGAAAGCCCCTGTGGGAAATCACACTCGGCGAGTACGCGACC
TGGTTCAAGGGCTTTGTCGCGTCATCCTGGATGTACACATCCATGACGGCCGCCATCCGAGTCGCCATCTTGCTC
TTCTACCGCCGCATCTTTTCACAAACCGTCTCGTGGCTGAGGGTGACGATCTACGTGCTGCTATCTCTCCAGGCC
GTCTATGTCATCGTCTATTCCATCCTTCCGGCCCTGGCCTGCCATCCGTTCGACAGCGCCTGGAACCCGTTCGAA
CGTCGTGCCCACTGCGACGACTGGTACTTTTACTATGACCAGGTGGCTCTTTACAGCACCAGCATGGTCTTCGAC
CTCGTGCTCTTGCTTCTTCCCCTCGAGCCGGCTCGGAGGCTTCAAATGCGTCGGAGCAAGAAAGCTGGCGTTATC
GTCATGTTCATTCTGGGAGCTGGCGCGAGCATCGTCACTGCAGTCAAACTGGGAATTTTCGTAACCGACATGAAC
GGCTATTCCGAGTTTGATCCTTACTTCGCCCGCTACCAACTCGTCTACTTCCTCCCGGCCCAGATGTCACACAAC
GGCTTGACCTTTTGGCTTCCATCGCACGTCGAGCCAACAGTAGCCCTCATAGGGGCCTCCCTGCCGGGCCTGCGA
CCGGCGCTCAACGTCATGAGCGCCAGCGTCTCGCAGAGGCTGAGGTCGCTCTATTATTCGCGCGGCACCAGCAGG
AGCGACAGCCGAGCCGTACAAGGAAGAACATGGGCCGGCCACGAGTTAGATGACAAGACGGTTGGATCGACGGCT
TCGAGCCGGCGACGAGACCGTGGCTTCGATATTACGCGCATCATCGAGACCAAGATCAGCTCCGAGACAGCGCAC
GGAAGCCAAGTTCAGCTGGGACAGTATCCGGCGCCCCATCCGACTCAATGA
Gene >Ophio5|2121
ATGGCACAAAACTTGACGGCCGAAGTTGCTTCGTTGCTGCCGCCACCGACGACGATCAATGATACGCACAAGGTC
TATGGAGTTGCTATTGCCTGTGCCGTCATGAGTGGCGTTGCTACCTCGGTTGTTTTGTGGCGTTTATACTTGAGA
TACGCTTCGCGGGCTTTCGGCCTTGATGACTGGGCCACCATTCCCGCCCTCGTTCGTTGACCCGTCTTCGACTCT
ATAGAGGATGGAGACAGCGTACTGACTTTACTTTGGGGTTGACGCCTGCGTAGATTCTATATCTTGGTTGGTCCA
TACTGGCCGTCTATGTGAACCTCGCCGGAGGCATCGGAAAGCCCCTGTGGGAAATCACACTCGGCGAGTACGCGA
CCTGGTTCAAGGTAAGGTTAGGGTTATTCGATGACGACCTTTGTTGATATAGACGTCTTAGGGCTTTGTCGCGTC
ATCCTGGATGTACACATCCATGACGGCCGCCATCCGAGTCGCCATCTTGCTCTTCTACCGCCGCATCTTTTCACA
AACCGTCTCGTGGCTGAGGGTGACGATCTACGTGCTGCTATCTCTCCAGGCCGTCTATGTCATCGTCTATTCCAT
CCTTCCGGCCCTGGCCTGCCATCCGTTCGACAGCGCCTGGAACCCGTTCGAACGTCGTGCCCACTGCGACGACTG
GTACTTTTACTATGACCAGGTGGCTCTTTACAGCACCAGCATGGTCTTCGACCTCGTGCTCTTGCTTCTTCCCCT
CGAGCCGGCTCGGAGGCTTCAAATGCGTCGGAGCAAGAAAGCTGGCGTTATCGTCATGTTCATTCTGGGAGCTGG
GTGAGTATAAACCATTTTTGGCGGCAATAAGTTCAAGTCCACGGGCTAGAAAATTGACGTTTGCCTCAGCGCGAG
CATCGTCACTGCAGTCAAACTGGGAATTTTCGTAACCGACATGAACGGCTATTCCGAGTTTGATCCTTACTGTGA
GTCGCAACTCCAGCCTCTGAGCCCCCAACCGGCCCTGAAGCTCATGAGACGCCATCCAGTCGCCCGCTACCAACT
CGTCTACTTCCTCCCGGCCCAGATGTCACACAACGGCTTGACCTTTTGGCTTCCATCGCACGTCGAGCCAACAGT
AGCCCTCATAGGGGCCTCCCTGCCGGGCCTGCGACCGGCGCTCAACGTCATGAGCGCCAGCGTCTCGCAGAGGCT
GAGGTCGCTCTATTATTCGCGCGGCACCAGCAGGAGCGACAGCCGAGCCGTACAAGGAAGAACATGGGCCGGCCA
CGAGTTAGATGACAAGACGGTTGGATCGACGGCTTCGAGCCGGCGACGAGACCGTGGCTTCGATATTACGCGCAT
CATCGAGACCAAGATCAGCTCCGAGACAGCGCACGGAAGCCAAGTTCAGCTGGGACAGTATCCGGCGCCCCATCC
GACTCAATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail