Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|2117
Gene name
Locationscaffold_186:27860..28239
Strand+
Gene length (bp)379
Transcript length (bp)312
Coding sequence length (bp)309
Protein length (aa) 103

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 18 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
SC16a Pure fungal culture 9.92 0.31 19.53
CcL In ants, during behavior modification 44.83 9.09 80.58
CcD In ants, recently dead 37.53 9.85 65.20

Differential expression

Label1 Label2 Q-value Significant difference
SC16a CcL 0.002047 yes
SC16a CcD 0.004810 yes
CcL CcD 0.681586 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|2117
MKFASAFALTLATVAVAHHQSGDGPGLTARDNVLVRRKECSGTRSAEDKCSGKRAKPQNSFHNCKNTDGKCCAKN
KDGSGGLDVSRGQGRDDCGYCFTGKCKA
Coding >Ophio5|2117
ATGAAGTTCGCATCTGCCTTTGCCCTGACGCTGGCGACCGTGGCCGTCGCTCATCATCAGTCCGGCGACGGGCCG
GGGCTCACGGCGCGGGATAACGTGCTGGTGCGCCGCAAGGAGTGTAGCGGAACGAGGAGCGCCGAAGATAAATGC
AGCGGCAAGCGGGCTAAACCTCAAAATTCGTTCCATAACTGTAAGAACACTGATGGAAAATGCTGCGCGAAGAAC
AAGGATGGAAGTGGTGGGCTGGATGTCAGTCGGGGTCAAGGTCGGGACGATTGTGGCTATTGCTTCACGGGGAAG
TGCAAGGCT
Transcript >Ophio5|2117
ATGAAGTTCGCATCTGCCTTTGCCCTGACGCTGGCGACCGTGGCCGTCGCTCATCATCAGTCCGGCGACGGGCCG
GGGCTCACGGCGCGGGATAACGTGCTGGTGCGCCGCAAGGAGTGTAGCGGAACGAGGAGCGCCGAAGATAAATGC
AGCGGCAAGCGGGCTAAACCTCAAAATTCGTTCCATAACTGTAAGAACACTGATGGAAAATGCTGCGCGAAGAAC
AAGGATGGAAGTGGTGGGCTGGATGTCAGTCGGGGTCAAGGTCGGGACGATTGTGGCTATTGCTTCACGGGGAAG
TGCAAGGCTTGA
Gene >Ophio5|2117
ATGAAGTTCGCATCTGCCTTTGCCCTGACGCTGGCGACCGTGGCCGTCGCTCATCATCAGTCCGGCGACGGGCCG
GGGCTCACGGCGCGGGATAACGTGCTGGTGCGCCGCAAGGAGTGTAGCGGAACGAGGAGCGCCGAAGATAAATGC
AGCGGCAAGCGGGCTAAACCTCAAAATTCGTTCCATAACTGGTAAGCTTGCCGATAATTCCTCCCGTCATCGACG
AATCACCCGCTCAACTCTCATCACTCGCCGCAGTAAGAACACTGATGGAAAATGCTGCGCGAAGAACAAGGATGG
AAGTGGTGGGCTGGATGTCAGTCGGGGTCAAGGTCGGGACGATTGTGGCTATTGCTTCACGGGGAAGTGCAAGGC
TTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail