Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|2117
Gene name
Locationscaffold_186:27860..28239
Strand+
Gene length (bp)379
Transcript length (bp)312
Coding sequence length (bp)309
Protein length (aa) 103

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Extracellular Signal peptide 0.0525 0.0609 0.9727 0.0465 0.0611 0.0051 0.0255 0.0723 0.0285 0.0034

SignalP

SignalP signal predicted Location Score
Yes 1 - 17 0.999639

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup6519
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis map64 (Brazil) OphauB2|583
Ophiocordyceps camponoti-floridani Ophcf2|06227
Ophiocordyceps kimflemingae Ophio5|2117 (this protein)
Ophiocordyceps subramaniannii Hirsu2|1175

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|2117
MKFASAFALTLATVAVAHHQSGDGPGLTARDNVLVRRKECSGTRSAEDKCSGKRAKPQNSFHNCKNTDGKCCAKN
KDGSGGLDVSRGQGRDDCGYCFTGKCKA
Coding >Ophio5|2117
ATGAAGTTCGCATCTGCCTTTGCCCTGACGCTGGCGACCGTGGCCGTCGCTCATCATCAGTCCGGCGACGGGCCG
GGGCTCACGGCGCGGGATAACGTGCTGGTGCGCCGCAAGGAGTGTAGCGGAACGAGGAGCGCCGAAGATAAATGC
AGCGGCAAGCGGGCTAAACCTCAAAATTCGTTCCATAACTGTAAGAACACTGATGGAAAATGCTGCGCGAAGAAC
AAGGATGGAAGTGGTGGGCTGGATGTCAGTCGGGGTCAAGGTCGGGACGATTGTGGCTATTGCTTCACGGGGAAG
TGCAAGGCT
Transcript >Ophio5|2117
ATGAAGTTCGCATCTGCCTTTGCCCTGACGCTGGCGACCGTGGCCGTCGCTCATCATCAGTCCGGCGACGGGCCG
GGGCTCACGGCGCGGGATAACGTGCTGGTGCGCCGCAAGGAGTGTAGCGGAACGAGGAGCGCCGAAGATAAATGC
AGCGGCAAGCGGGCTAAACCTCAAAATTCGTTCCATAACTGTAAGAACACTGATGGAAAATGCTGCGCGAAGAAC
AAGGATGGAAGTGGTGGGCTGGATGTCAGTCGGGGTCAAGGTCGGGACGATTGTGGCTATTGCTTCACGGGGAAG
TGCAAGGCTTGA
Gene >Ophio5|2117
ATGAAGTTCGCATCTGCCTTTGCCCTGACGCTGGCGACCGTGGCCGTCGCTCATCATCAGTCCGGCGACGGGCCG
GGGCTCACGGCGCGGGATAACGTGCTGGTGCGCCGCAAGGAGTGTAGCGGAACGAGGAGCGCCGAAGATAAATGC
AGCGGCAAGCGGGCTAAACCTCAAAATTCGTTCCATAACTGGTAAGCTTGCCGATAATTCCTCCCGTCATCGACG
AATCACCCGCTCAACTCTCATCACTCGCCGCAGTAAGAACACTGATGGAAAATGCTGCGCGAAGAACAAGGATGG
AAGTGGTGGGCTGGATGTCAGTCGGGGTCAAGGTCGGGACGATTGTGGCTATTGCTTCACGGGGAAGTGCAAGGC
TTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail