Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|2111
Gene name
Locationscaffold_186:13860..17394
Strand+
Gene length (bp)3534
Transcript length (bp)3156
Coding sequence length (bp)3153
Protein length (aa) 1051

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 26 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
SC16a Pure fungal culture 0.00 0.00 0.00
CcL In ants, during behavior modification 1.58 0.01 3.16
CcD In ants, recently dead 0.15 0.00 0.35

Differential expression

Label1 Label2 Q-value Significant difference
SC16a CcL 0.000286 yes
SC16a CcD 1.000000 no
CcL CcD 0.006016 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|2111
MRHHWATVTCQVAFYLLLWTTYTSADGAEPAMQVAPNGDGFSAVFPPESPGTEPSSQTARAALFARGKDDKSGET
SSAFSEEPTPSTSGTQRKFYEAKPPGPYHGSTVHLTLKTGRGGPGRNEIDKWRQHVIREGFQNPLHRNPPPRLRS
WPGRMSSSLISHIRSGTQSASGMVLALVGRGAHQPALQDPSFSGGRGSPHSLDHTVLRGSPGLRVVVTVGLYNPE
HAAPPVPDSTRLIPPPEPTGCGKDGTPLYQWWFHWNSHANDKSLRTNATKPFQLIPKKGGFFLPLPGSIGSYYEH
CGPTEFKGRESGFPPRLLDFPGALGSTWHFAPLEESSSSSSDLTLVGGTCSPPDYLPESELGQRQELLNMIQFMN
SYPGLPLVRRAGNLMYDILLMVVGDVPKAMKAVHQGCDGVIAHYLMTLAPHFVQILLRMWHQMLKQSTRRKRDHY
SINETEATGWLCNWLAFDVPTFYELEESLPNGLYVDCNSSDDLTPRGEFLGSRVRSLTLGNYTRDQLCGLMSSTY
KLSRESGINTVSSIYVDCGASNLASLNEKSSAVDDDDYDDNNDHYHDENDGRDIAPGGPSPKIGSLSSKDDKSLT
PNSQGGKPGHDNGCSTISELELGFQLDSKENSASKDSIYVSFGDFNHQLVVKNPWSGFHNWLQLDLKAMFGTKKT
ITFEDLRQINFWSVRNEDMQDGWGFQGIKLKAKCFGSGITWETDKYQRINEWMHRPNDIAKARVWQGVIEPHDWI
DYPHIRSCPIFDKLEFSFFPGPHSDGSGDISYLYFPYWGRHDVRFTGEQGWQSWQTIDLKQVFHEPEVSLQAIHE
LAIKQYHVGDADNHGWDIPSTSRELGLGKFNNITPQVRYNIWGGHITYSYWNDSVDHLKDWVLLSDCARFDRLEV
LLGISGSLMGGTKHSLWVTFDKDRHHSAPEQMITSEGAKDFTYRKSIDLQKMFGTKYVWMQDITWFRIFAKPDGK
RPDQWKVTKVFFKGRCADDHSKVYLHDEHDKIEDWFDSSFDPPHKDVTRDVSSHYWRLDSNTEEFVQHHTHDGSE
F
Coding >Ophio5|2111
ATGCGCCATCACTGGGCCACGGTCACCTGTCAGGTCGCATTTTACCTCCTTCTATGGACGACTTACACCTCAGCC
GACGGTGCGGAACCTGCGATGCAAGTGGCGCCCAACGGAGATGGTTTTTCGGCAGTTTTCCCCCCTGAATCCCCG
GGCACGGAACCTTCTTCGCAGACGGCTCGTGCGGCACTGTTCGCGAGAGGGAAAGACGACAAGTCAGGGGAAACG
TCTTCGGCCTTTTCCGAGGAACCGACGCCTTCGACTTCGGGGACGCAGCGCAAGTTTTATGAAGCCAAGCCTCCG
GGTCCGTATCATGGAAGTACGGTCCATTTGACGCTGAAGACTGGGCGAGGAGGTCCGGGCAGAAATGAGATTGAC
AAATGGCGCCAGCATGTCATTCGGGAGGGCTTCCAAAACCCCCTTCATCGGAATCCGCCTCCTCGTCTCCGAAGC
TGGCCTGGTCGTATGTCCTCGTCCTTAATCAGCCATATCAGGAGTGGGACGCAATCCGCGTCTGGCATGGTGTTG
GCATTGGTGGGCAGAGGTGCTCACCAGCCAGCACTTCAAGATCCTTCCTTCTCAGGCGGTCGGGGAAGTCCTCAT
TCTCTAGACCATACTGTGCTAAGGGGCTCTCCCGGATTGAGAGTTGTTGTTACCGTGGGCTTGTACAACCCCGAG
CACGCAGCCCCCCCAGTTCCAGATTCTACCAGGCTGATACCTCCTCCTGAACCAACTGGTTGCGGCAAGGATGGC
ACCCCTTTGTACCAATGGTGGTTCCACTGGAATTCTCACGCCAACGACAAGTCTCTTCGAACCAATGCCACCAAA
CCTTTCCAGCTGATCCCGAAAAAGGGCGGATTCTTTCTTCCTCTACCCGGCTCTATCGGCTCGTACTACGAACAT
TGTGGCCCGACCGAGTTCAAAGGACGAGAATCGGGATTCCCACCAAGACTTCTCGATTTCCCAGGCGCACTGGGA
TCAACATGGCATTTTGCACCGTTGGAAGAATCTTCATCATCGTCTTCCGACTTGACACTTGTCGGCGGTACCTGT
TCTCCACCTGACTATCTCCCTGAAAGCGAGTTGGGGCAGAGGCAAGAGCTTCTGAATATGATTCAGTTTATGAAT
TCATACCCCGGCCTCCCCTTGGTTCGACGCGCCGGTAATCTGATGTATGACATATTGTTGATGGTGGTCGGAGAT
GTGCCAAAAGCTATGAAAGCAGTCCACCAAGGATGTGATGGAGTGATTGCACATTACTTGATGACGCTTGCACCA
CACTTTGTTCAAATCCTTCTGCGCATGTGGCATCAAATGTTGAAACAGTCTACACGCCGCAAAAGGGATCATTAT
AGTATCAACGAAACAGAAGCAACCGGTTGGCTCTGCAACTGGTTGGCGTTTGACGTCCCGACATTCTATGAGCTC
GAAGAATCTCTTCCAAACGGCTTATACGTGGATTGCAATAGCTCAGACGATCTAACGCCAAGGGGGGAATTCTTG
GGCAGCCGCGTCAGGAGCTTAACTCTGGGCAATTACACGCGAGACCAACTCTGTGGCCTAATGTCGAGTACCTAC
AAGCTGTCTCGAGAGTCTGGCATCAACACGGTGTCGTCCATCTATGTGGACTGCGGCGCGTCAAACCTTGCCTCG
TTGAACGAGAAAAGCTCTGCTGTCGATGACGATGACTATGATGACAACAACGACCATTATCACGACGAAAATGAT
GGCCGGGATATCGCTCCAGGCGGCCCAAGTCCAAAAATCGGTTCCCTCTCCTCTAAAGACGACAAGAGCCTCACT
CCGAACAGCCAAGGAGGGAAACCCGGTCACGACAACGGATGCTCCACCATCTCCGAATTAGAGCTCGGGTTTCAG
CTCGACAGCAAAGAAAATTCCGCCAGCAAAGACTCCATTTATGTTAGCTTCGGCGATTTTAACCATCAGCTGGTG
GTGAAGAATCCATGGAGCGGGTTTCATAACTGGTTGCAGCTTGATCTCAAAGCCATGTTTGGGACGAAGAAGACG
ATTACCTTTGAAGACCTGCGTCAAATAAATTTCTGGTCTGTACGGAATGAGGATATGCAAGACGGTTGGGGTTTC
CAAGGGATCAAGCTAAAGGCAAAATGCTTTGGCTCTGGCATAACTTGGGAGACGGACAAATACCAAAGAATAAAC
GAGTGGATGCATCGCCCAAACGACATTGCCAAAGCCAGGGTTTGGCAAGGTGTTATAGAGCCTCATGACTGGATC
GATTACCCCCACATCAGGTCATGTCCGATATTCGACAAGCTGGAGTTCAGCTTCTTCCCAGGACCTCACTCGGAC
GGGTCTGGTGATATCTCATACCTCTACTTCCCATACTGGGGAAGACACGACGTCCGTTTCACGGGCGAACAAGGT
TGGCAATCGTGGCAAACCATTGATCTCAAACAGGTTTTTCACGAGCCTGAAGTTTCGTTGCAGGCCATTCATGAG
CTCGCCATTAAGCAGTATCATGTTGGCGATGCGGACAATCACGGCTGGGATATTCCGAGCACGTCCAGAGAGCTC
GGACTTGGCAAGTTCAACAACATCACTCCACAGGTCCGATACAACATCTGGGGGGGTCACATAACGTACTCGTAC
TGGAATGATAGCGTCGACCATCTCAAGGATTGGGTCCTGCTGTCCGACTGCGCTCGTTTCGATCGCTTGGAAGTC
CTGCTGGGAATCAGCGGCTCCCTCATGGGCGGCACAAAGCATTCACTCTGGGTCACGTTCGACAAGGACAGACAT
CACAGCGCCCCCGAACAGATGATAACATCGGAAGGCGCAAAAGATTTCACTTACCGTAAAAGCATCGACCTGCAA
AAGATGTTTGGGACGAAATATGTCTGGATGCAAGATATCACCTGGTTCAGGATCTTTGCGAAACCAGATGGCAAA
AGGCCAGACCAATGGAAGGTTACCAAGGTTTTCTTCAAGGGACGCTGTGCCGACGATCACTCCAAGGTTTACTTG
CACGACGAACATGACAAGATCGAGGATTGGTTTGATTCCTCCTTCGACCCGCCACATAAAGATGTGACCCGTGAC
GTCTCGAGTCACTATTGGCGACTGGACAGCAACACGGAAGAATTTGTCCAACACCACACGCATGACGGAAGCGAG
TTC
Transcript >Ophio5|2111
ATGCGCCATCACTGGGCCACGGTCACCTGTCAGGTCGCATTTTACCTCCTTCTATGGACGACTTACACCTCAGCC
GACGGTGCGGAACCTGCGATGCAAGTGGCGCCCAACGGAGATGGTTTTTCGGCAGTTTTCCCCCCTGAATCCCCG
GGCACGGAACCTTCTTCGCAGACGGCTCGTGCGGCACTGTTCGCGAGAGGGAAAGACGACAAGTCAGGGGAAACG
TCTTCGGCCTTTTCCGAGGAACCGACGCCTTCGACTTCGGGGACGCAGCGCAAGTTTTATGAAGCCAAGCCTCCG
GGTCCGTATCATGGAAGTACGGTCCATTTGACGCTGAAGACTGGGCGAGGAGGTCCGGGCAGAAATGAGATTGAC
AAATGGCGCCAGCATGTCATTCGGGAGGGCTTCCAAAACCCCCTTCATCGGAATCCGCCTCCTCGTCTCCGAAGC
TGGCCTGGTCGTATGTCCTCGTCCTTAATCAGCCATATCAGGAGTGGGACGCAATCCGCGTCTGGCATGGTGTTG
GCATTGGTGGGCAGAGGTGCTCACCAGCCAGCACTTCAAGATCCTTCCTTCTCAGGCGGTCGGGGAAGTCCTCAT
TCTCTAGACCATACTGTGCTAAGGGGCTCTCCCGGATTGAGAGTTGTTGTTACCGTGGGCTTGTACAACCCCGAG
CACGCAGCCCCCCCAGTTCCAGATTCTACCAGGCTGATACCTCCTCCTGAACCAACTGGTTGCGGCAAGGATGGC
ACCCCTTTGTACCAATGGTGGTTCCACTGGAATTCTCACGCCAACGACAAGTCTCTTCGAACCAATGCCACCAAA
CCTTTCCAGCTGATCCCGAAAAAGGGCGGATTCTTTCTTCCTCTACCCGGCTCTATCGGCTCGTACTACGAACAT
TGTGGCCCGACCGAGTTCAAAGGACGAGAATCGGGATTCCCACCAAGACTTCTCGATTTCCCAGGCGCACTGGGA
TCAACATGGCATTTTGCACCGTTGGAAGAATCTTCATCATCGTCTTCCGACTTGACACTTGTCGGCGGTACCTGT
TCTCCACCTGACTATCTCCCTGAAAGCGAGTTGGGGCAGAGGCAAGAGCTTCTGAATATGATTCAGTTTATGAAT
TCATACCCCGGCCTCCCCTTGGTTCGACGCGCCGGTAATCTGATGTATGACATATTGTTGATGGTGGTCGGAGAT
GTGCCAAAAGCTATGAAAGCAGTCCACCAAGGATGTGATGGAGTGATTGCACATTACTTGATGACGCTTGCACCA
CACTTTGTTCAAATCCTTCTGCGCATGTGGCATCAAATGTTGAAACAGTCTACACGCCGCAAAAGGGATCATTAT
AGTATCAACGAAACAGAAGCAACCGGTTGGCTCTGCAACTGGTTGGCGTTTGACGTCCCGACATTCTATGAGCTC
GAAGAATCTCTTCCAAACGGCTTATACGTGGATTGCAATAGCTCAGACGATCTAACGCCAAGGGGGGAATTCTTG
GGCAGCCGCGTCAGGAGCTTAACTCTGGGCAATTACACGCGAGACCAACTCTGTGGCCTAATGTCGAGTACCTAC
AAGCTGTCTCGAGAGTCTGGCATCAACACGGTGTCGTCCATCTATGTGGACTGCGGCGCGTCAAACCTTGCCTCG
TTGAACGAGAAAAGCTCTGCTGTCGATGACGATGACTATGATGACAACAACGACCATTATCACGACGAAAATGAT
GGCCGGGATATCGCTCCAGGCGGCCCAAGTCCAAAAATCGGTTCCCTCTCCTCTAAAGACGACAAGAGCCTCACT
CCGAACAGCCAAGGAGGGAAACCCGGTCACGACAACGGATGCTCCACCATCTCCGAATTAGAGCTCGGGTTTCAG
CTCGACAGCAAAGAAAATTCCGCCAGCAAAGACTCCATTTATGTTAGCTTCGGCGATTTTAACCATCAGCTGGTG
GTGAAGAATCCATGGAGCGGGTTTCATAACTGGTTGCAGCTTGATCTCAAAGCCATGTTTGGGACGAAGAAGACG
ATTACCTTTGAAGACCTGCGTCAAATAAATTTCTGGTCTGTACGGAATGAGGATATGCAAGACGGTTGGGGTTTC
CAAGGGATCAAGCTAAAGGCAAAATGCTTTGGCTCTGGCATAACTTGGGAGACGGACAAATACCAAAGAATAAAC
GAGTGGATGCATCGCCCAAACGACATTGCCAAAGCCAGGGTTTGGCAAGGTGTTATAGAGCCTCATGACTGGATC
GATTACCCCCACATCAGGTCATGTCCGATATTCGACAAGCTGGAGTTCAGCTTCTTCCCAGGACCTCACTCGGAC
GGGTCTGGTGATATCTCATACCTCTACTTCCCATACTGGGGAAGACACGACGTCCGTTTCACGGGCGAACAAGGT
TGGCAATCGTGGCAAACCATTGATCTCAAACAGGTTTTTCACGAGCCTGAAGTTTCGTTGCAGGCCATTCATGAG
CTCGCCATTAAGCAGTATCATGTTGGCGATGCGGACAATCACGGCTGGGATATTCCGAGCACGTCCAGAGAGCTC
GGACTTGGCAAGTTCAACAACATCACTCCACAGGTCCGATACAACATCTGGGGGGGTCACATAACGTACTCGTAC
TGGAATGATAGCGTCGACCATCTCAAGGATTGGGTCCTGCTGTCCGACTGCGCTCGTTTCGATCGCTTGGAAGTC
CTGCTGGGAATCAGCGGCTCCCTCATGGGCGGCACAAAGCATTCACTCTGGGTCACGTTCGACAAGGACAGACAT
CACAGCGCCCCCGAACAGATGATAACATCGGAAGGCGCAAAAGATTTCACTTACCGTAAAAGCATCGACCTGCAA
AAGATGTTTGGGACGAAATATGTCTGGATGCAAGATATCACCTGGTTCAGGATCTTTGCGAAACCAGATGGCAAA
AGGCCAGACCAATGGAAGGTTACCAAGGTTTTCTTCAAGGGACGCTGTGCCGACGATCACTCCAAGGTTTACTTG
CACGACGAACATGACAAGATCGAGGATTGGTTTGATTCCTCCTTCGACCCGCCACATAAAGATGTGACCCGTGAC
GTCTCGAGTCACTATTGGCGACTGGACAGCAACACGGAAGAATTTGTCCAACACCACACGCATGACGGAAGCGAG
TTCTGA
Gene >Ophio5|2111
ATGCGCCATCACTGGGCCACGGTCACCTGTCAGGTCGCATTTTACCTCCTTCTATGGACGACTTACACCTCAGCC
GACGGTGCGGAACCTGCGATGCAAGTGGCGCCCAACGGAGATGGTTTTTCGGCAGTTTTCCCCCCTGAATCCCCG
GGCACGGAACCTTCTTCGCAGACGGCTCGTGCGGCACTGTTCGCGAGAGGGAAAGACGACAAGTCAGGGGAAACG
TCTTCGGCCTTTTCCGAGGAACCGACGCCTTCGACTTCGGGGACGCAGCGCAAGTTTTATGAAGCCAAGCCTCCG
GGTCCGTATCATGGAAGTACGGTCCATTTGACGCTGAAGACTGGGCGAGGAGGTCCGGGCAGAAATGAGATTGAC
AAATGGCGCCAGCATGTCATTCGGGAGGGCTTCCAAAACCCCCTTCATCGGAATCCGCCTCCTCGTCTCCGAAGC
TGGCCTGGTCGTATGTCCTCGTCCTTAATCAGCCATATCAGGAGTGGGACGCAATCCGCGTCTGGCATGGTGTTG
GCATTGGTGGGCAGAGGTGCTCACCAGCCAGCACTTCAAGATCCTTCCTTCTCAGGCGGTCGGGGAAGTCCTCAT
TCTCTAGACCATACTGTGCTAAGGGGCTCTCCCGGATTGAGAGTTGTTGTTACCGTGGGCTTGTACAACCCCGAG
CACGCAGCCCCCCCAGTTCCAGATTCTACCAGGCTGATACCTCCTCCTGAACCAACTGGTTGCGGCAAGGATGGC
ACCCCTTTGTACCAATGGTGGTTCCACTGGAATTCTCACGCCAACGACAAGTCTCTTCGAACCAATGCCACCAAA
CCTTTCCAGCTGATCCCGAAAAAGGGCGGATTCTTTCTTCCTCTACCCGGCTCTATCGGCTCGTACTACGAACAT
TGTGGCCCGACCGAGTTCAAAGGACGAGAATCGGGATTCCCACCAAGACTTCTCGATTTCCCAGGCGCACTGGGA
TCAACATGGCATTTTGCACCGTTGGAAGAATCTTCATCATCGTCTTCCGACTTGACACTTGTCGGCGGTACCTGT
TCTCCACCTGACTATCTCCCTGAAAGCGAGTTGGGGCAGAGGCAAGAGCTTCTGAATATGATTCAGTTTATGAAT
TCATACCCCGGCCTCCCCTTGGTTCGACGCGCCGGTAATCTGATGTATGACATATTGTTGATGGTGGTCGGAGAT
GTGCCAAAAGCTATGAAAGCAGTCCACCAAGGATGTGATGGAGTGATTGCACATTACTTGATGACGCTTGCACCA
CACTTTGTTCAAATCCTTCTGCGCATGTGGCATCAAATGTTGAAACAGTCTACACGCCGCAAAAGGGATCATTAT
AGTATCAACGGTAAGCTCAACCCGTCCGACCATGGTCAAAACACACTCATGATACTTTTGGTTCAGAAACAGAAG
CAACCGGTTGGCTCTGCAACTGGTTGGCGTTTGACGTCCCGACATTCTATGAGCTCGAAGAATCTCTTCCAAACG
GCTTATACGTGGATTGCAATAGCTCAGACGAGTAAGATGTCGCTTCTCCAACCTGGGAAACAATAATGTATCAGT
CTAACGCCAAGGGGGGAATTCTTGGGCAGCCGCGTCAGGAGCTTAACTCTGGGCAATTACACGCGAGACCAACTC
TGTGGCCTAATGTCGAGTACCTACAAGCTGTCTCGAGAGTCTGGCATCAACACGGTGTCGTCCATCTATGTGGAC
TGCGGCGCGTCAAACCTTGCCTCGTTGAACGAGAAAAGCTCTGCTGTCGATGACGATGACTATGATGACAACAAC
GACCATTATCACGACGAAAATGATGGCCGGGATATCGCTCCAGGCGGCCCAAGTCCAAAAATCGGTTCCCTCTCC
TCTAAAGACGACAAGAGCCTCACTCCGAACAGCCAAGGAGGGAAACCCGGTCACGACAACGGATGCTCCACCATC
TCCGAATTAGAGCTCGGGTTTCAGCTCGACAGCAAAGAAAATTCCGCCAGCAAAGACTCCATTTATGTTAGCTTC
GGCGATTTTAACCATCAGCTGGTGGTGAAGAATCCATGGAGCGGGTTTCATAACTGGTTGCAGCTTGATCTCAAA
GCCATGTTTGGGACGAAGAAGACGATTACCTTTGAAGACCTGCGTCAAATAAATTTCTGGTCTGTACGGAATGAG
GATATGCAAGACGGTTGGGGTTTCCAAGGTTTGTGCCCCCCTTCCCTCCCCCCCCCCCCTTTTTTTTTTCTTTCA
GGAAGCTCGACGTAACGTATCGCGGACGAGAGACACTGACTCTGACTTCTAAGGGATCAAGCTAAAGGCAAAATG
CTTTGGCTCTGGCATAACTTGGGAGACGGACAAATACCAAAGAATAAACGAGTGGATGCATCGCCCAAACGACAT
TGCCAAAGCCAGGGTTTGGCAAGGTGTTATAGAGCCTCATGACTGGATCGATTACCCCCACATCAGGTCATGTCC
GATATTCGACAAGCTGGAGTTCAGCTTCTTCCCAGGACCTCACTCGGACGGGTCTGGTGATATCTCATACCTCTA
CTTCCCATACTGGGGAAGACACGACGTCCGTTTCACGGGCGAACAAGGTTGGCAATCGTGGCAAACCATTGATCT
CAAACAGGTTTTTCACGAGCCTGAAGTTTCGTTGCAGGCCATTCATGAGCTCGCCATTAAGCAGTATCATGTTGG
CGATGCGGACAATCACGGCTGGGATATTCCGAGTAGGTCGACTATTCTCTTCAATTTTTTTTTTCTTTCTTTCTT
TCTTATACACTCCTCATAATGGCAGCTAACGAGCTACATGGAAGGCTTCAGGTTGAGGGCTTCGTGCAAAGGCAC
GTCCAGAGAGCTCGGACTTGGCAAGTTCAACAACATCACTCCACAGGTCCGATACAACATCTGGGGGGGTCACAT
AACGTACTCGTACTGGAATGATAGCGTCGACCATCTCAAGGATTGGGTCCTGCTGTCCGACTGCGCTCGTTTCGA
TCGCTTGGAAGTCCTGCTGGGAATCAGCGGCTCCCTCATGGGCGGCACAAAGCATTCACTCTGGGTCACGTTCGA
CAAGGACAGACATCACAGCGCCCCCGAACAGATGATAACATCGGAAGGCGCAAAAGATTTCACTTACCGTAAAAG
CATCGACCTGCAAAAGATGTTTGGGACGAAATATGTCTGGATGCAAGATATCACCTGGTTCAGGATCTTTGCGAA
ACCAGATGGCAAAAGGCCAGACCAATGGAAGGTTACCAGTATGTGTTCTTGTCCAACCTTTTCTCCCTTCCCGCA
TGGGCTCGCTAATCTTTTGGCCCCCCAGAGGTTTTCTTCAAGGGACGCTGTGCCGACGATCACTCCAAGGTTTAC
TTGCACGACGAACATGACAAGATCGAGGATTGGTTTGATTCCTCCTTCGACCCGCCACATAAAGATGTGACCCGT
GACGTCTCGAGTCACTATTGGCGACTGGACAGCAACACGGAAGAATTTGTCCAACACCACACGCATGACGGAAGC
GAGTTCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail