Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|2110
Gene name
Locationscaffold_186:10239..12213
Strand-
Gene length (bp)1974
Transcript length (bp)1695
Coding sequence length (bp)1692
Protein length (aa) 564

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04820 Trp_halogenase Tryptophan halogenase 4.6E-12 9 65
PF04820 Trp_halogenase Tryptophan halogenase 2.8E-11 154 366
PF01494 FAD_binding_3 FAD binding domain 4.7E-11 7 369
PF13450 NAD_binding_8 NAD(P)-binding Rossmann-like domain 1.2E-04 11 38

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q0VZ69|THAL_CHOCO Tryptophan 2-halogenase OS=Chondromyces crocatus GN=cmdE PE=4 SV=1 1 387 3.0E-64

GO

GO Term Description Terminal node
GO:0071949 FAD binding Yes
GO:0004497 monooxygenase activity Yes
GO:0036094 small molecule binding No
GO:0097159 organic cyclic compound binding No
GO:0005488 binding No
GO:1901265 nucleoside phosphate binding No
GO:0016491 oxidoreductase activity No
GO:0000166 nucleotide binding No
GO:0003824 catalytic activity No
GO:0003674 molecular_function No
GO:0043167 ion binding No
GO:0043168 anion binding No
GO:1901363 heterocyclic compound binding No
GO:0050660 flavin adenine dinucleotide binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 22 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|2110
MAVPKSCTVLIIGAGPAGSYAACCLAREGIDTVVLEADKFPRYHIGESTLPSLRHFFKFIDVDDAFDAYGFFKKG
SSRNGAVFRLNQAHPDALTDFIEAGGPDGYAWNLIRAESDDLLFRHAKACGAHTFDETKVDSIQFERGTDRTCFG
EGQDKAMDSGRPVSATWSRKDGSAGTIAFKYLIDASGRHGILSTKYLKSRRFNRGFKNVASWAYWKSDNLYGQGT
SWEGLPYFEALQDASGWCWYMPLHDGTRSVGIVQDQAMATDKKRKLGKPSTSEFYRQSLELATRTNELLSGATLA
SDIKSASDWSYTSSTYHIPYARICGDAGCFIDPLFSSGVHLAIAGGLSAAVTIAASLKGDYDEETAGSWHSKKTV
ESYARFLLAVCAATKQIRYEDEPVMHDFDEEGLQRAFDILQPIIQGTVDGEARGRTTDIEVSQVLKFCFRAFNYV
PHEKKEALFEKLDRLDPGFGEGDAAKRIEEMHKHLTAEEMEIVEALRSRRLIREDVFTLGSFTLDIIDGLAPRLV
RGELGLVKASKARLDSRHFLSAPFLDGKVEAIRTHGEGI
Coding >Ophio5|2110
ATGGCTGTTCCGAAAAGTTGTACAGTTCTGATCATTGGGGCCGGTCCTGCAGGATCATACGCGGCCTGTTGTTTG
GCACGTGAGGGCATCGACACGGTTGTGCTCGAGGCAGACAAGTTTCCCCGATATCATATTGGAGAGAGCACGCTT
CCTTCGCTGCGGCACTTCTTCAAGTTTATAGACGTTGACGATGCCTTTGATGCTTATGGCTTCTTCAAGAAGGGA
AGTAGTCGCAACGGAGCAGTGTTTCGGCTCAATCAAGCTCATCCCGATGCGTTAACCGACTTCATCGAGGCGGGC
GGGCCCGACGGTTATGCCTGGAACTTGATCCGGGCCGAATCCGACGACTTGCTCTTCAGGCACGCAAAAGCGTGC
GGGGCTCACACCTTTGACGAAACCAAGGTTGACTCGATTCAATTCGAGCGAGGCACAGACAGGACATGCTTCGGT
GAGGGTCAGGACAAGGCCATGGATTCAGGCCGGCCCGTATCGGCAACCTGGAGCCGCAAAGACGGCTCGGCCGGA
ACCATCGCCTTCAAGTATCTCATTGATGCCAGTGGAAGACACGGAATTCTGAGCACCAAGTACCTAAAGAGCAGG
AGGTTTAATCGCGGCTTCAAGAATGTCGCCAGTTGGGCCTATTGGAAGAGCGACAACTTATACGGTCAGGGAACG
TCCTGGGAGGGCCTTCCGTATTTTGAGGCGCTGCAAGATGCCAGCGGTTGGTGTTGGTATATGCCGCTTCACGAC
GGCACTCGCTCCGTCGGCATCGTCCAGGACCAAGCCATGGCGACGGATAAGAAGCGAAAGCTGGGGAAGCCATCG
ACGTCGGAATTTTATAGGCAGTCTCTCGAGCTGGCCACTCGGACTAATGAGTTGCTCTCCGGGGCTACGCTTGCC
AGCGATATCAAGTCGGCGTCAGACTGGTCCTACACGTCGTCCACCTACCACATTCCATATGCGCGCATCTGTGGA
GACGCTGGATGCTTCATCGACCCTCTTTTCTCATCAGGCGTCCACCTGGCCATCGCAGGCGGCCTCTCGGCGGCA
GTCACCATCGCCGCGTCGCTCAAGGGCGACTACGACGAGGAGACTGCAGGCTCGTGGCATTCCAAGAAGACGGTC
GAAAGCTATGCCCGTTTCCTGCTGGCCGTCTGCGCCGCCACGAAGCAAATTCGATACGAGGATGAGCCCGTGATG
CACGACTTTGACGAGGAGGGTTTGCAGAGGGCGTTTGATATCCTTCAACCCATTATCCAGGGTACGGTCGACGGC
GAGGCCCGGGGAAGGACGACGGATATTGAAGTATCCCAGGTACTGAAATTCTGTTTCCGGGCGTTCAACTACGTC
CCGCACGAGAAGAAGGAAGCCTTGTTCGAGAAGCTCGACAGACTCGACCCCGGTTTCGGTGAAGGGGATGCTGCG
AAACGCATCGAGGAGATGCATAAGCACCTGACTGCCGAAGAGATGGAGATAGTAGAGGCACTGCGGAGTCGGCGA
TTGATTCGCGAAGACGTCTTCACCCTGGGCAGCTTCACGCTCGACATCATTGACGGACTGGCGCCCAGGCTGGTG
CGAGGCGAGCTCGGCCTCGTCAAGGCTAGCAAGGCCCGGCTCGACAGTCGTCACTTTTTATCGGCGCCTTTCTTG
GATGGCAAGGTTGAGGCGATTCGGACGCATGGAGAGGGGATC
Transcript >Ophio5|2110
ATGGCTGTTCCGAAAAGTTGTACAGTTCTGATCATTGGGGCCGGTCCTGCAGGATCATACGCGGCCTGTTGTTTG
GCACGTGAGGGCATCGACACGGTTGTGCTCGAGGCAGACAAGTTTCCCCGATATCATATTGGAGAGAGCACGCTT
CCTTCGCTGCGGCACTTCTTCAAGTTTATAGACGTTGACGATGCCTTTGATGCTTATGGCTTCTTCAAGAAGGGA
AGTAGTCGCAACGGAGCAGTGTTTCGGCTCAATCAAGCTCATCCCGATGCGTTAACCGACTTCATCGAGGCGGGC
GGGCCCGACGGTTATGCCTGGAACTTGATCCGGGCCGAATCCGACGACTTGCTCTTCAGGCACGCAAAAGCGTGC
GGGGCTCACACCTTTGACGAAACCAAGGTTGACTCGATTCAATTCGAGCGAGGCACAGACAGGACATGCTTCGGT
GAGGGTCAGGACAAGGCCATGGATTCAGGCCGGCCCGTATCGGCAACCTGGAGCCGCAAAGACGGCTCGGCCGGA
ACCATCGCCTTCAAGTATCTCATTGATGCCAGTGGAAGACACGGAATTCTGAGCACCAAGTACCTAAAGAGCAGG
AGGTTTAATCGCGGCTTCAAGAATGTCGCCAGTTGGGCCTATTGGAAGAGCGACAACTTATACGGTCAGGGAACG
TCCTGGGAGGGCCTTCCGTATTTTGAGGCGCTGCAAGATGCCAGCGGTTGGTGTTGGTATATGCCGCTTCACGAC
GGCACTCGCTCCGTCGGCATCGTCCAGGACCAAGCCATGGCGACGGATAAGAAGCGAAAGCTGGGGAAGCCATCG
ACGTCGGAATTTTATAGGCAGTCTCTCGAGCTGGCCACTCGGACTAATGAGTTGCTCTCCGGGGCTACGCTTGCC
AGCGATATCAAGTCGGCGTCAGACTGGTCCTACACGTCGTCCACCTACCACATTCCATATGCGCGCATCTGTGGA
GACGCTGGATGCTTCATCGACCCTCTTTTCTCATCAGGCGTCCACCTGGCCATCGCAGGCGGCCTCTCGGCGGCA
GTCACCATCGCCGCGTCGCTCAAGGGCGACTACGACGAGGAGACTGCAGGCTCGTGGCATTCCAAGAAGACGGTC
GAAAGCTATGCCCGTTTCCTGCTGGCCGTCTGCGCCGCCACGAAGCAAATTCGATACGAGGATGAGCCCGTGATG
CACGACTTTGACGAGGAGGGTTTGCAGAGGGCGTTTGATATCCTTCAACCCATTATCCAGGGTACGGTCGACGGC
GAGGCCCGGGGAAGGACGACGGATATTGAAGTATCCCAGGTACTGAAATTCTGTTTCCGGGCGTTCAACTACGTC
CCGCACGAGAAGAAGGAAGCCTTGTTCGAGAAGCTCGACAGACTCGACCCCGGTTTCGGTGAAGGGGATGCTGCG
AAACGCATCGAGGAGATGCATAAGCACCTGACTGCCGAAGAGATGGAGATAGTAGAGGCACTGCGGAGTCGGCGA
TTGATTCGCGAAGACGTCTTCACCCTGGGCAGCTTCACGCTCGACATCATTGACGGACTGGCGCCCAGGCTGGTG
CGAGGCGAGCTCGGCCTCGTCAAGGCTAGCAAGGCCCGGCTCGACAGTCGTCACTTTTTATCGGCGCCTTTCTTG
GATGGCAAGGTTGAGGCGATTCGGACGCATGGAGAGGGGATCTGA
Gene >Ophio5|2110
ATGGCTGTTCCGAAAAGTTGTACAGTTCTGATCATTGGGGCCGGTCCTGCAGGATCATACGCGGCCTGTTGTTTG
GCACGTGAGGGCATCGACACGGTTGTGCTCGAGGCAGACAAGTTTCCCCGGTTAGTGAGCAGCCTGTAACTTGAT
TAGCATCTCGTTTTGACGGTTGGTAGATATCATATTGGAGAGAGCACGCTTCCTTCGCTGCGGCACTTCTTCAAG
TTTATAGACGTTGACGATGCCTTTGATGCTTATGGCTTCTTCAAGAAGGGAAGTAGTCGCGTGCGGAAACGTACA
GACTACAGAAAATGACTCTTAGCTTGCAGAACGGAGCAGTGTTTCGGCTCAATCAAGCTCATCCCGATGCGTGTA
AGTCTGCATCTGCCACTGCATAAATCCTCCAGGCAATTGAGCTCACGTCTGATCAGTAACCGACTTCATCGAGGC
GGGCGGGCCCGACGGTTATGCCTGGAACTTGATCCGGGCCGAATCCGACGACTTGCTCTTCAGGCACGCAAAAGC
GTGCGGGGCTCACACCTTTGACGAAACCAAGGTTGACTCGATTCAATTCGAGCGAGGCACAGACAGGACATGCTT
CGGTGAGGGTCAGGACAAGGCCATGGATTCAGGCCGGCCCGTATCGGCAACCTGGAGCCGCAAAGACGGCTCGGC
CGGAACCATCGCCTTCAAGTATCTCATTGATGCCAGTGGAAGACACGGAATTCTGAGCACCAAGTACCTAAAGAG
CAGGAGGTTTAATCGCGGCTTCAAGAATGTCGCCAGTTGGGCCTATTGGAAGAGCGACAACTTATACGGTCAGGG
AACGTCCTGGGAGGGCCTTCCGTATTTTGAGGCGCTGCAAGGTCAGTTATTCAAGGCTTGCACTTGTCGTCCATC
CATGTTCAACTCGGCGTGACAGATGCCAGCGGTTGGTGTTGGTATATGCCGCTTCACGACGGCACTCGCTCCGTC
GGCATCGTCCAGGACCAAGCCATGGCGACGGATAAGAAGCGAAAGCTGGGGAAGCCATCGACGTCGGAATTTTAT
AGGCAGTCTCTCGAGCTGGCCACTCGGACTAATGAGTTGCTCTCCGGGGCTACGCTTGCCAGCGATATCAAGTCG
GCGTCAGACTGGTCCTACACGTCGTCCACCTACCACATTCCATATGCGCGCATCTGTGGAGACGCTGGATGCTTC
ATCGACCCTCTTTTCTCATCAGGCGTCCACCTGGCCATCGCAGGCGGCCTCTCGGCGGCAGTCACCATCGCCGCG
TCGCTCAAGGGCGACTACGACGAGGAGACTGCAGGCTCGTGGCATTCCAAGAAGACGGTCGAAAGCTATGCCCGT
TTCCTGCTGGCCGTCTGCGCCGCCACGAAGCAAATTCGATACGAGGATGAGCCCGTGATGCACGACTTTGACGAG
GAGGGTTTGCAGAGGGCGTTTGATATCCTTCAACCCAGTAAGAAAGCCGAGCGTAGCGGCATTCAAGAATAGGCT
ATTGCAAAGCCGGCTAACATCAGCCTTCCAGTTATCCAGGGTACGGTCGACGGCGAGGCCCGGGGAAGGACGACG
GATATTGAAGTATCCCAGGTACTGAAATTCTGTTTCCGGGCGTTCAACTACGTCCCGCACGAGAAGAAGGAAGCC
TTGTTCGAGAAGCTCGACAGACTCGACCCCGGTTTCGGTGAAGGGGATGCTGCGAAACGCATCGAGGAGATGCAT
AAGCACCTGACTGCCGAAGAGATGGAGATAGTAGAGGCACTGCGGAGTCGGCGATTGATTCGCGAAGACGTCTTC
ACCCTGGGCAGCTTCACGCTCGACATCATTGACGGACTGGCGCCCAGGCTGGTGCGAGGCGAGCTCGGCCTCGTC
AAGGCTAGCAAGGCCCGGCTCGACAGTCGTCACTTTTTATCGGCGCCTTTCTTGGATGGCAAGGTTGAGGCGATT
CGGACGCATGGAGAGGGGATCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail