Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|2102
Gene name
Locationscaffold_185:17915..21283
Strand+
Gene length (bp)3368
Transcript length (bp)3186
Coding sequence length (bp)3183
Protein length (aa) 1061

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF16187 Peptidase_M16_M Middle or third domain of peptidase_M16 6.7E-97 399 686
PF05193 Peptidase_M16_C Peptidase M16 inactive domain 1.5E-18 213 392
PF05193 Peptidase_M16_C Peptidase M16 inactive domain 3.8E-13 691 873
PF00675 Peptidase_M16 Insulinase (Peptidase family M16) 1.5E-30 38 186

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q24K02|IDE_BOVIN Insulin-degrading enzyme OS=Bos taurus GN=IDE PE=2 SV=1 22 945 0.0E+00
sp|O14077|MU138_SCHPO Putative zinc protease mug138 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mug138 PE=1 SV=1 19 942 0.0E+00
sp|P22817|IDE_DROME Insulin-degrading enzyme OS=Drosophila melanogaster GN=Ide PE=1 SV=4 3 973 0.0E+00
sp|Q06010|STE23_YEAST A-factor-processing enzyme OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=STE23 PE=1 SV=2 18 945 0.0E+00
sp|Q9JHR7|IDE_MOUSE Insulin-degrading enzyme OS=Mus musculus GN=Ide PE=1 SV=1 12 945 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q24K02|IDE_BOVIN Insulin-degrading enzyme OS=Bos taurus GN=IDE PE=2 SV=1 22 945 0.0E+00
sp|O14077|MU138_SCHPO Putative zinc protease mug138 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mug138 PE=1 SV=1 19 942 0.0E+00
sp|P22817|IDE_DROME Insulin-degrading enzyme OS=Drosophila melanogaster GN=Ide PE=1 SV=4 3 973 0.0E+00
sp|Q06010|STE23_YEAST A-factor-processing enzyme OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=STE23 PE=1 SV=2 18 945 0.0E+00
sp|Q9JHR7|IDE_MOUSE Insulin-degrading enzyme OS=Mus musculus GN=Ide PE=1 SV=1 12 945 0.0E+00
sp|P35559|IDE_RAT Insulin-degrading enzyme OS=Rattus norvegicus GN=Ide PE=1 SV=1 12 945 0.0E+00
sp|P14735|IDE_HUMAN Insulin-degrading enzyme OS=Homo sapiens GN=IDE PE=1 SV=4 12 945 0.0E+00
sp|O22941|PXM16_ARATH Zinc-metallopeptidase, peroxisomal OS=Arabidopsis thaliana GN=PXM16 PE=2 SV=1 18 967 7.0E-179
sp|Q5R4H6|NRDC_PONAB Nardilysin OS=Pongo abelii GN=NRD1 PE=2 SV=1 47 951 1.0E-131
sp|Q8BHG1|NRDC_MOUSE Nardilysin OS=Mus musculus GN=Nrd1 PE=1 SV=1 47 951 7.0E-131
sp|O43847|NRDC_HUMAN Nardilysin OS=Homo sapiens GN=NRD1 PE=1 SV=2 47 951 9.0E-130
sp|P47245|NRDC_RAT Nardilysin OS=Rattus norvegicus GN=Nrd1 PE=1 SV=1 47 951 5.0E-128
sp|Q54JQ2|IDE_DICDI Insulin-degrading enzyme homolog OS=Dictyostelium discoideum GN=DDB_G0287851 PE=3 SV=1 22 946 5.0E-90
sp|Q8CVS2|PTRA_ECOL6 Protease 3 OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=ptrA PE=3 SV=1 12 926 3.0E-85
sp|Q8ZMB5|PTRA_SALTY Protease 3 OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=ptrA PE=3 SV=1 12 926 6.0E-85
sp|Q83QC3|PTRA_SHIFL Protease 3 OS=Shigella flexneri GN=ptrA PE=3 SV=1 12 926 3.0E-84
sp|P05458|PTRA_ECOLI Protease 3 OS=Escherichia coli (strain K12) GN=ptrA PE=1 SV=1 12 926 8.0E-84
sp|Q8X6M8|PTRA_ECO57 Protease 3 OS=Escherichia coli O157:H7 GN=ptrA PE=3 SV=1 12 926 4.0E-83
sp|Q8Z418|PTRA_SALTI Protease 3 OS=Salmonella typhi GN=ptrA PE=3 SV=1 12 926 1.0E-82
sp|Q10040|YQA4_CAEEL Putative zinc protease C28F5.4 OS=Caenorhabditis elegans GN=C28F5.4 PE=3 SV=2 14 401 2.0E-82
sp|P42789|SDP_EIMBO Sporozoite developmental protein OS=Eimeria bovis PE=2 SV=1 13 588 3.0E-47
sp|P40851|AXL1_YEAST Putative protease AXL1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AXL1 PE=1 SV=2 20 370 3.0E-39
sp|Q10040|YQA4_CAEEL Putative zinc protease C28F5.4 OS=Caenorhabditis elegans GN=C28F5.4 PE=3 SV=2 506 942 1.0E-33
sp|Q88QV3|PQQF_PSEPK Coenzyme PQQ synthesis protein F OS=Pseudomonas putida (strain KT2440) GN=pqqF PE=3 SV=1 27 337 5.0E-21
sp|Q9I2D2|PQQF_PSEAE Coenzyme PQQ synthesis protein F OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=pqqF PE=3 SV=1 31 330 1.0E-15
sp|P55174|PQQF_PSEPH Coenzyme PQQ synthesis protein F OS=Pseudomonas protegens (strain DSM 19095 / CHA0) GN=pqqF PE=3 SV=1 39 243 3.0E-15
sp|P27508|PQQF_KLEPN Coenzyme PQQ synthesis protein F OS=Klebsiella pneumoniae GN=pqqF PE=3 SV=1 27 242 4.0E-14
sp|Q88A79|PQQF_PSESM Coenzyme PQQ synthesis protein F OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=pqqF PE=3 SV=1 19 243 8.0E-12
sp|P55679|Y4WA_RHISN Uncharacterized zinc protease y4wA OS=Rhizobium sp. (strain NGR234) GN=NGR_a01040 PE=3 SV=1 31 235 7.0E-08
sp|P45181|PQQL_HAEIN Probable zinc protease PqqL OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=pqqL PE=3 SV=1 30 290 2.0E-06
sp|Q4UML9|Y338_RICFE Uncharacterized zinc protease RF_0338 OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=RF_0338 PE=3 SV=1 25 305 4.0E-06
sp|Q1RJ61|Y522_RICBR Uncharacterized zinc protease RBE_0522 OS=Rickettsia bellii (strain RML369-C) GN=RBE_0522 PE=3 SV=1 25 305 7.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|2102
MAPGRRAPVIVLADCLEKPSLDDRDYRVVRLENELEALLVHDPETDKASAALDVNVGNFSDEEGMPGMAHAVEHL
LFMGTKKFPVENEYNQYLAANSGASNAYTASTSTNYFFDVAAKPANDEDPSDSNPSPLRGALDRFAQFFVEPLFL
PSTLDRELKAVDSENKKNLQNDTWRLHQLGKSQSNPKHPFCHFSTGNLSVLKTQPEARGVNVRDKFIEFHDKHYS
ANRMKLVVLGREPLDVLQKWVVELFSPIVNKKLPPNRWSDEVPFRDCDLATQCFAKPVMDTRQLDLTFPFVDEEA
LFESQPSRYISHLIGHEGPGSIMSYVKNKGWVNGLSAWASSVCPGTPGMFEVQIRLTEEGLKNYPEIVKIFFQYV
SLLREASPQEWIFDEQKGMADVDFKFRQKTPASRFTSRTSSVMQKPLPREWLLSGNSRLRTFDAKLIEDALSTIR
PDKLRLMIVSRTFPGNWNAKEKWYGTEYRCEKIPDDLMAELNRAMALSASERLPELHLPHKNNFIPSKLEVDKKD
VAEPAPAPRVLRNDALARTWWKKDDTFWVPKANVMVSLKNPIIHATAENSVKARIFAELVRDEFEEYSYDAELAG
LQYTVSLDLRGLFLDISGYNDKLPVLLKQVVVTIRDLDIRTERFDIVKERLTRGYKNFQLQSSYQQIGDYVSWLN
AERDYVVEELEAELKNITVDSVRLFHRQMLAQLYVEIYAHGNLYRDEALMVTDMVVSTFKARALPRWQCPVIRSL
TLPPGSNFVFNKTLEDPANVNHCVETWFFVGDRADGLARAKTLLVDQMTHEPAFDQLRTKEQLGYIVFSGIRNFA
TTCGFRILIQSEKTPEYLEKRIEAFLAQFSRALMTMSEAEFEGHKRSLIIRRLEKLRSLDQESSRHWTQISNEYY
DFEQAQVDAANIKPLTKAEMVDFYNEFLSPSSSRRARLSVHLHARGAGELDLKVVNLLRASGLDDVPQAKRSCLA
HLESYLKDVVNAPADRREMIIRQAKDLGLDLTVSSAEFEGEESVESAVGPAKEITDVRLHRAGLPASRGARPAKE
LSEFEETDAKL
Coding >Ophio5|2102
ATGGCTCCGGGTCGCCGGGCCCCCGTCATCGTCCTGGCCGACTGCCTGGAGAAGCCGTCGTTGGATGATCGTGAT
TACCGAGTCGTCAGGCTCGAAAACGAGCTCGAGGCCTTGCTGGTTCACGATCCCGAGACGGACAAGGCCAGCGCC
GCCCTCGACGTCAATGTCGGCAACTTTTCCGATGAAGAGGGCATGCCCGGCATGGCCCACGCTGTCGAGCATCTT
CTGTTCATGGGCACCAAAAAGTTTCCCGTCGAAAACGAGTACAACCAGTATCTCGCCGCCAACTCTGGCGCTTCC
AACGCCTACACGGCCAGCACCTCCACCAATTATTTTTTCGACGTTGCCGCGAAGCCGGCCAATGACGAGGATCCG
TCAGACAGCAATCCGTCGCCTCTGCGCGGCGCCCTGGACCGCTTCGCCCAGTTCTTCGTCGAGCCCCTTTTTCTG
CCGAGCACGCTCGACAGGGAGTTGAAAGCTGTCGACTCGGAGAACAAGAAGAATCTGCAAAACGACACCTGGCGT
CTCCACCAGCTCGGCAAGTCGCAGTCCAACCCCAAGCATCCCTTCTGCCACTTCTCCACCGGTAATTTGAGTGTG
CTCAAGACGCAGCCCGAAGCGAGGGGAGTCAACGTGCGGGACAAGTTTATCGAGTTTCACGATAAGCACTACTCT
GCGAACCGCATGAAGCTTGTTGTCCTCGGCCGTGAGCCGCTCGATGTCCTCCAAAAATGGGTCGTCGAACTCTTT
TCTCCCATTGTCAACAAGAAGTTGCCGCCCAACAGGTGGTCTGACGAGGTCCCGTTCCGCGACTGCGATCTGGCG
ACGCAGTGCTTCGCCAAGCCCGTCATGGATACGCGCCAGCTCGACTTGACGTTTCCCTTCGTGGACGAGGAGGCG
CTCTTCGAGTCGCAGCCTAGCAGGTACATCAGCCACCTCATAGGCCACGAGGGTCCTGGAAGCATCATGTCGTAT
GTCAAGAACAAGGGCTGGGTAAACGGTCTGTCAGCCTGGGCCTCTTCAGTCTGTCCCGGAACACCTGGCATGTTT
GAAGTGCAGATTCGCCTGACGGAAGAAGGTCTGAAGAATTATCCCGAGATTGTCAAAATCTTCTTCCAGTACGTG
TCTTTGCTGCGGGAGGCCTCTCCCCAGGAATGGATTTTCGACGAGCAAAAGGGAATGGCCGACGTGGATTTCAAG
TTCAGGCAGAAGACGCCGGCCAGCCGATTCACGAGTAGGACGAGTTCCGTCATGCAGAAGCCTCTGCCGCGCGAA
TGGCTACTCAGCGGCAACAGTCGTCTGCGTACTTTTGACGCCAAGCTCATCGAGGACGCGCTGTCCACAATTCGG
CCGGACAAGCTGCGCTTGATGATTGTGTCGAGGACCTTTCCGGGAAACTGGAACGCCAAGGAGAAGTGGTATGGG
ACCGAGTACCGCTGCGAGAAGATTCCCGATGATCTGATGGCCGAGCTGAACCGCGCCATGGCGCTTTCTGCTTCG
GAGCGTCTTCCCGAGCTTCACCTGCCGCACAAGAACAACTTTATCCCCAGCAAGCTCGAGGTGGACAAGAAGGAC
GTGGCGGAACCGGCTCCCGCGCCGCGAGTGCTCCGCAACGACGCACTGGCCCGCACCTGGTGGAAGAAGGACGAC
ACCTTTTGGGTTCCCAAGGCTAACGTCATGGTGAGCCTGAAGAACCCCATCATCCACGCGACGGCGGAGAATAGT
GTCAAGGCGAGAATCTTTGCCGAGCTCGTTAGAGATGAATTTGAAGAGTATTCGTACGATGCAGAGCTAGCCGGT
CTGCAGTACACCGTGTCGCTGGACTTGCGCGGCCTTTTCTTGGACATTTCTGGATACAACGACAAGCTCCCGGTT
CTGCTGAAGCAGGTCGTCGTCACCATCCGGGATCTCGACATCAGGACGGAGCGGTTCGACATTGTCAAGGAGCGC
CTGACTCGCGGATACAAGAATTTCCAGCTGCAGTCGTCGTATCAACAGATTGGCGACTACGTTTCGTGGCTGAAT
GCGGAGCGCGATTATGTCGTGGAAGAGCTCGAGGCGGAGCTCAAGAACATAACCGTCGACTCCGTCAGGCTGTTT
CACAGGCAGATGCTGGCCCAGCTGTACGTCGAAATCTACGCTCACGGGAACCTGTATCGGGACGAGGCCCTGATG
GTGACGGACATGGTCGTCTCTACCTTCAAGGCGCGGGCGCTGCCTCGGTGGCAATGCCCCGTCATCCGCTCGCTC
ACACTGCCTCCGGGGTCCAACTTTGTCTTCAATAAGACCCTGGAGGACCCGGCCAACGTCAACCACTGCGTCGAA
ACGTGGTTCTTCGTCGGCGATCGGGCCGACGGCCTCGCGCGCGCCAAGACGTTACTGGTTGACCAGATGACGCAC
GAGCCCGCCTTTGACCAGCTCAGGACCAAGGAGCAACTTGGGTACATTGTCTTTTCGGGCATACGCAACTTTGCC
ACGACCTGCGGCTTCCGCATCTTGATTCAGAGCGAGAAGACGCCCGAGTATCTGGAGAAGCGTATCGAGGCCTTC
CTGGCCCAGTTTAGCAGGGCTCTGATGACGATGAGCGAGGCCGAGTTTGAAGGTCACAAACGGAGTCTCATCATC
AGGCGGTTGGAGAAGCTGAGGAGCCTGGACCAAGAGTCGTCGAGGCATTGGACTCAGATCAGCAATGAGTACTAC
GACTTTGAGCAAGCGCAAGTCGACGCTGCCAACATCAAGCCCCTCACCAAGGCCGAGATGGTGGACTTTTACAAC
GAGTTTCTCAGCCCGTCGTCGAGTCGTCGAGCGCGCCTGTCGGTCCACCTGCACGCCCGGGGTGCCGGCGAGCTG
GACCTGAAGGTGGTGAATCTCTTGCGAGCGTCAGGCCTCGACGACGTGCCTCAGGCGAAACGATCGTGCCTAGCC
CACCTCGAAAGCTACCTCAAGGACGTGGTAAACGCGCCCGCGGACAGGAGAGAGATGATAATCAGGCAGGCAAAG
GACCTCGGGCTCGACTTGACCGTCTCAAGCGCCGAGTTTGAAGGGGAGGAATCCGTGGAGTCGGCAGTTGGGCCG
GCCAAGGAAATCACCGACGTGCGTCTGCACAGGGCGGGTCTCCCGGCGAGCCGGGGAGCAAGGCCGGCCAAGGAG
CTGAGCGAGTTTGAGGAGACGGACGCGAAGTTA
Transcript >Ophio5|2102
ATGGCTCCGGGTCGCCGGGCCCCCGTCATCGTCCTGGCCGACTGCCTGGAGAAGCCGTCGTTGGATGATCGTGAT
TACCGAGTCGTCAGGCTCGAAAACGAGCTCGAGGCCTTGCTGGTTCACGATCCCGAGACGGACAAGGCCAGCGCC
GCCCTCGACGTCAATGTCGGCAACTTTTCCGATGAAGAGGGCATGCCCGGCATGGCCCACGCTGTCGAGCATCTT
CTGTTCATGGGCACCAAAAAGTTTCCCGTCGAAAACGAGTACAACCAGTATCTCGCCGCCAACTCTGGCGCTTCC
AACGCCTACACGGCCAGCACCTCCACCAATTATTTTTTCGACGTTGCCGCGAAGCCGGCCAATGACGAGGATCCG
TCAGACAGCAATCCGTCGCCTCTGCGCGGCGCCCTGGACCGCTTCGCCCAGTTCTTCGTCGAGCCCCTTTTTCTG
CCGAGCACGCTCGACAGGGAGTTGAAAGCTGTCGACTCGGAGAACAAGAAGAATCTGCAAAACGACACCTGGCGT
CTCCACCAGCTCGGCAAGTCGCAGTCCAACCCCAAGCATCCCTTCTGCCACTTCTCCACCGGTAATTTGAGTGTG
CTCAAGACGCAGCCCGAAGCGAGGGGAGTCAACGTGCGGGACAAGTTTATCGAGTTTCACGATAAGCACTACTCT
GCGAACCGCATGAAGCTTGTTGTCCTCGGCCGTGAGCCGCTCGATGTCCTCCAAAAATGGGTCGTCGAACTCTTT
TCTCCCATTGTCAACAAGAAGTTGCCGCCCAACAGGTGGTCTGACGAGGTCCCGTTCCGCGACTGCGATCTGGCG
ACGCAGTGCTTCGCCAAGCCCGTCATGGATACGCGCCAGCTCGACTTGACGTTTCCCTTCGTGGACGAGGAGGCG
CTCTTCGAGTCGCAGCCTAGCAGGTACATCAGCCACCTCATAGGCCACGAGGGTCCTGGAAGCATCATGTCGTAT
GTCAAGAACAAGGGCTGGGTAAACGGTCTGTCAGCCTGGGCCTCTTCAGTCTGTCCCGGAACACCTGGCATGTTT
GAAGTGCAGATTCGCCTGACGGAAGAAGGTCTGAAGAATTATCCCGAGATTGTCAAAATCTTCTTCCAGTACGTG
TCTTTGCTGCGGGAGGCCTCTCCCCAGGAATGGATTTTCGACGAGCAAAAGGGAATGGCCGACGTGGATTTCAAG
TTCAGGCAGAAGACGCCGGCCAGCCGATTCACGAGTAGGACGAGTTCCGTCATGCAGAAGCCTCTGCCGCGCGAA
TGGCTACTCAGCGGCAACAGTCGTCTGCGTACTTTTGACGCCAAGCTCATCGAGGACGCGCTGTCCACAATTCGG
CCGGACAAGCTGCGCTTGATGATTGTGTCGAGGACCTTTCCGGGAAACTGGAACGCCAAGGAGAAGTGGTATGGG
ACCGAGTACCGCTGCGAGAAGATTCCCGATGATCTGATGGCCGAGCTGAACCGCGCCATGGCGCTTTCTGCTTCG
GAGCGTCTTCCCGAGCTTCACCTGCCGCACAAGAACAACTTTATCCCCAGCAAGCTCGAGGTGGACAAGAAGGAC
GTGGCGGAACCGGCTCCCGCGCCGCGAGTGCTCCGCAACGACGCACTGGCCCGCACCTGGTGGAAGAAGGACGAC
ACCTTTTGGGTTCCCAAGGCTAACGTCATGGTGAGCCTGAAGAACCCCATCATCCACGCGACGGCGGAGAATAGT
GTCAAGGCGAGAATCTTTGCCGAGCTCGTTAGAGATGAATTTGAAGAGTATTCGTACGATGCAGAGCTAGCCGGT
CTGCAGTACACCGTGTCGCTGGACTTGCGCGGCCTTTTCTTGGACATTTCTGGATACAACGACAAGCTCCCGGTT
CTGCTGAAGCAGGTCGTCGTCACCATCCGGGATCTCGACATCAGGACGGAGCGGTTCGACATTGTCAAGGAGCGC
CTGACTCGCGGATACAAGAATTTCCAGCTGCAGTCGTCGTATCAACAGATTGGCGACTACGTTTCGTGGCTGAAT
GCGGAGCGCGATTATGTCGTGGAAGAGCTCGAGGCGGAGCTCAAGAACATAACCGTCGACTCCGTCAGGCTGTTT
CACAGGCAGATGCTGGCCCAGCTGTACGTCGAAATCTACGCTCACGGGAACCTGTATCGGGACGAGGCCCTGATG
GTGACGGACATGGTCGTCTCTACCTTCAAGGCGCGGGCGCTGCCTCGGTGGCAATGCCCCGTCATCCGCTCGCTC
ACACTGCCTCCGGGGTCCAACTTTGTCTTCAATAAGACCCTGGAGGACCCGGCCAACGTCAACCACTGCGTCGAA
ACGTGGTTCTTCGTCGGCGATCGGGCCGACGGCCTCGCGCGCGCCAAGACGTTACTGGTTGACCAGATGACGCAC
GAGCCCGCCTTTGACCAGCTCAGGACCAAGGAGCAACTTGGGTACATTGTCTTTTCGGGCATACGCAACTTTGCC
ACGACCTGCGGCTTCCGCATCTTGATTCAGAGCGAGAAGACGCCCGAGTATCTGGAGAAGCGTATCGAGGCCTTC
CTGGCCCAGTTTAGCAGGGCTCTGATGACGATGAGCGAGGCCGAGTTTGAAGGTCACAAACGGAGTCTCATCATC
AGGCGGTTGGAGAAGCTGAGGAGCCTGGACCAAGAGTCGTCGAGGCATTGGACTCAGATCAGCAATGAGTACTAC
GACTTTGAGCAAGCGCAAGTCGACGCTGCCAACATCAAGCCCCTCACCAAGGCCGAGATGGTGGACTTTTACAAC
GAGTTTCTCAGCCCGTCGTCGAGTCGTCGAGCGCGCCTGTCGGTCCACCTGCACGCCCGGGGTGCCGGCGAGCTG
GACCTGAAGGTGGTGAATCTCTTGCGAGCGTCAGGCCTCGACGACGTGCCTCAGGCGAAACGATCGTGCCTAGCC
CACCTCGAAAGCTACCTCAAGGACGTGGTAAACGCGCCCGCGGACAGGAGAGAGATGATAATCAGGCAGGCAAAG
GACCTCGGGCTCGACTTGACCGTCTCAAGCGCCGAGTTTGAAGGGGAGGAATCCGTGGAGTCGGCAGTTGGGCCG
GCCAAGGAAATCACCGACGTGCGTCTGCACAGGGCGGGTCTCCCGGCGAGCCGGGGAGCAAGGCCGGCCAAGGAG
CTGAGCGAGTTTGAGGAGACGGACGCGAAGTTATGA
Gene >Ophio5|2102
ATGGCTCCGGGTCGCCGGGCCCCCGTCATCGTCCTGGCCGACTGCCTGGAGAAGCCGTCGTTGGATGATCGTGAT
TACCGAGTCGTCAGGCTCGAAAACGAGCTCGAGGCCTTGCTGGTTCACGATCCCGAGACGGACAAGGCCAGCGCC
GCCCTCGACGTCAATGTCGGCAACTTTTCCGATGAAGAGGGCATGCCCGGCATGGCCCACGCTGTCGAGCATGTG
CGCGCCGCCATCGTCTTTTTTTCTCTTCTTGTTTAGCTGCTTTCATCGTGAATGCTGACCAAGGTAGCTTCTGTT
CATGGGCACCAAAAAGTTTCCCGTCGAAAACGAGTACAACCAGTATCTCGCCGCCAACTCTGGCGCTTCCAACGC
CTACACGGCCAGCACCTCCACCAATTATTTTTTCGACGTTGCCGCGAAGCCGGCCAATGACGAGGATCCGTCAGA
CAGCAATCCGTCGCCTCTGCGCGGCGCCCTGGACCGCTTCGCCCAGTTCTTCGTCGAGCCCCTTTTTCTGCCGAG
CACGCTCGACAGGGAGTTGAAAGCTGTCGACTCGGAGAACAAGAAGAATCTGCAAAACGACACCTGGCGTCTCCA
CCAGCTCGGCAAGTCGCAGTCCAACCCCAAGCATCCCTTCTGCCACTTCTCCACCGGTAATTTGAGTGTGCTCAA
GACGCAGCCCGAAGCGAGGGGAGTCAACGTGCGGGACAAGTTTATCGAGTTTCACGATAAGCACTACTCTGCGAA
CCGCATGAAGCTTGTTGTCCTCGGCCGTGAGCCGCTCGATGTCCTCCAAAAATGGGTCGTCGAACTCTTTTCTCC
CATTGTCAACAAGAAGTTGCCGCCCAACAGGTGGTCTGACGAGGTCCCGTTCCGCGACTGCGATCTGGCGACGCA
GTGCTTCGCCAAGCCCGTCATGGATACGCGCCAGCTCGACTTGACGTTTCCCTTCGTGGACGAGGAGGCGCTCTT
CGAGTCGCAGCCTAGCAGGTACATCAGCCACCTCATAGGCCACGAGGGTCCTGGAAGCATCATGTCGTATGTCAA
GAACAAGGGCTGGGTAAACGGTCTGTCAGCCTGGGCCTCTTCAGTCTGTCCCGGAACACCTGGCATGTTTGAAGT
GCAGATTCGCCTGACGGAAGAAGTATGCGCTCCCCTGCCCCTTTCCGCGCCTCGCCGACGGCGACACTGACGCAG
CTTGTCAAGGGTCTGAAGAATTATCCCGAGATTGTCAAAATCTTCTTCCAGTACGTGTCTTTGCTGCGGGAGGCC
TCTCCCCAGGAATGGATTTTCGACGAGCAAAAGGGAATGGCCGACGTGGATTTCAAGTTCAGGCAGAAGACGCCG
GCCAGCCGATTCACGAGTAGGACGAGTTCCGTCATGCAGAAGCCTCTGCCGCGCGAATGGCTACTCAGCGGCAAC
AGTCGTCTGCGTACTTTTGACGCCAAGCTCATCGAGGACGCGCTGTCCACAATTCGGCCGGACAAGCTGCGCTTG
ATGATTGTGTCGAGGACCTTTCCGGGAAACTGGAACGCCAAGGAGAAGTGGTATGGGACCGAGTACCGCTGCGAG
AAGATTCCCGATGATCTGATGGCCGAGCTGAACCGCGCCATGGCGCTTTCTGCTTCGGAGCGTCTTCCCGAGCTT
CACCTGCCGCACAAGAACAACTTTATCCCCAGCAAGCTCGAGGTGGACAAGAAGGACGTGGCGGAACCGGCTCCC
GCGCCGCGAGTGCTCCGCAACGACGCACTGGCCCGCACCTGGTGGAAGAAGGACGACACCTTTTGGGTTCCCAAG
GCTAACGTCATGGTGAGCCTGAAGAACCCCATCATCCACGCGACGGCGGAGAATAGTGTCAAGGCGAGAATCTTT
GCCGAGCTCGTTAGAGATGAATTTGAAGAGTATTCGTACGATGCAGAGCTAGCCGGTCTGCAGTACACCGTGTCG
CTGGACTTGCGCGGCCTTTTCTTGGACATTTCTGGATACAACGACAAGCTCCCGGTTCTGCTGAAGCAGGTCGTC
GTCACCATCCGGGATCTCGACATCAGGACGGAGCGGTTCGACATTGTCAAGGAGCGCCTGACTCGCGGATACAAG
AATTTCCAGCTGCAGTCGTCGTATCAACAGATTGGCGACTACGTTTCGTGGCTGAATGCGGAGCGCGATTATGTC
GTGGAAGAGCTCGAGGCGGAGCTCAAGAACATAACCGTCGACTCCGTCAGGCTGTTTCACAGGCAGATGCTGGCC
CAGCTGTACGTCGAAATCTACGCTCACGGGAACCTGTATCGGGACGAGGCCCTGATGGTGACGGACATGGTCGTC
TCTACCTTCAAGGCGCGGGCGCTGCCTCGGTGGCAATGCCCCGTCATCCGCTCGCTCACACTGCCTCCGGGGTCC
AACTTTGTCTTCAATAAGACCCTGGAGGACCCGGCCAACGTCAACCACTGCGTCGAAACGTGGTTCTTCGTCGGC
GATCGGGCCGACGGCCTCGCGCGCGCCAAGACGTTACTGGTTGACCAGATGACGCACGAGCCCGCCTTTGACCAG
CTCAGGACCAAGGAGCAACTTGGGTACATTGTCTTTTCGGGCATACGCAACTTTGCCACGACCTGCGGCTTCCGC
ATCTTGATTCAGAGCGAGAAGACGCCCGAGTATCTGGAGAAGCGTATCGAGGCCTTCCTGGCCCAGTTTAGCAGG
GCTCTGATGACGATGAGCGAGGCCGAGTTTGAAGGTCACAAACGGAGTCTCATCATCAGGCGGTTGGAGAAGCTG
AGGAGCCTGGACCAAGAGTCGTCGAGGCATTGGACTCAGATCAGCAATGAGTACTACGACTTTGAGCAAGGTGCG
TGGACCCGAAACACCATGGGCGAACTAGCTGACAATTATGCACAGCGCAAGTCGACGCTGCCAACATCAAGCCCC
TCACCAAGGCCGAGATGGTGGACTTTTACAACGAGTTTCTCAGCCCGTCGTCGAGTCGTCGAGCGCGCCTGTCGG
TCCACCTGCACGCCCGGGGTGCCGGCGAGCTGGACCTGAAGGTGGTGAATCTCTTGCGAGCGTCAGGCCTCGACG
ACGTGCCTCAGGCGAAACGATCGTGCCTAGCCCACCTCGAAAGCTACCTCAAGGACGTGGTAAACGCGCCCGCGG
ACAGGAGAGAGATGATAATCAGGCAGGCAAAGGACCTCGGGCTCGACTTGACCGTCTCAAGCGCCGAGTTTGAAG
GGGAGGAATCCGTGGAGTCGGCAGTTGGGCCGGCCAAGGAAATCACCGACGTGCGTCTGCACAGGGCGGGTCTCC
CGGCGAGCCGGGGAGCAAGGCCGGCCAAGGAGCTGAGCGAGTTTGAGGAGACGGACGCGAAGTTATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail